CAZyme Information: AFUB_013680-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_013680-T-p1
• CAZy Family: AA7
• CAZyme Description: Has domain(s) with predicted transferase activity, transferring hexosyl groups activity, role in GPI anchor biosynthetic process and endoplasmic reticulum membrane, integral to membrane localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		34907.74	9.5506

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000001_A_fumigatus_A1163:3846077-3847082(-)

Full Sequence      

MASSSSSISLPMVSAFEPAVHWRTNNYPALQKTGAVDYAFREHVAGIIIAHAAHGLSVLV
LYCLGCAIFSGRKGRMLAFIAACLHIFSPAGLFLSAPYGESTYALLSFTGYFLFVQSFSP
SGASTSLKDARIPLAGILCGLATTVRSNGILNGLLFLEEAIRALYSLTGAITFAKFRRLL
AVGVAGICTALGFVVPQYIAYRDFCINYPFTGHDEPRIWCRRTLPSISSFVQDHYWNNGF
LRYWTVSNIPLFALASPMLAIMTYSALWTLNVESGRLTGAGRLLRSLAAPQLILAALTFS
KHHVQIITRMSSGYLVWYF

Enzyme Prediction     

No EC number prediction in AFUB_013680-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	36	318	1.9e-74	0.6609336609336609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	4.93e-24	44	267	120	318	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.88e-14	43	319	116	363	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAF32128.1|GT76	3.30e-160	1	236	316	551
BAE62404.1|GT76	8.03e-137	24	318	152	461
QRD83592.1|GT76	1.27e-136	30	318	107	410
QMW32162.1|GT76	1.27e-136	30	318	107	410
UDD57107.1|GT76	1.27e-136	30	318	107	410

PDB Hits     

AFUB_013680-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	4.59e-69	44	318	113	385	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	1.64e-68	42	318	137	432	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	6.22e-64	57	318	121	392	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	1.71e-62	42	318	107	382	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	8.92e-30	47	318	92	322	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999947	0.000048

TMHMM  Annotations     

Start	End
47	69
76	98
134	156
179	201
246	268