CAZyme Information: AFUB_005070-T-p1

Basic Information

• Species: Aspergillus fumigatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fumigatus
• CAZyme ID: AFUB_005070-T-p1
• CAZy Family: AA6
• CAZyme Description: Ortholog(s) have xyloglucan-specific endo-beta-1,4-glucanase activity and role in xyloglucan metabolic process, glucan catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238	scf_000001_A_fumigatus_A1163|CGC4	25298.05	4.2924

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfumigatusA1163	10106	451804	199	9907

• Gene Location: location=scf_000001_A_fumigatus_A1163:1421810-1422576(+)

Full Sequence      

MKLSLSVALSLAAATAQAATQFCDQWGSVTEGNYILYNNLWGQAQATSGSQCTTFESLSG
NTIVWNTKWSWSGGQGQVKSFANAALQFTPKKLSSVKSIDSTWKWNYSGSNIVADVAYDM
FLSTSPGGDHNYEIMVWLGALGGAGPISSTGSPIATPTVAGIKFNLYLGPNGSMQVYSFV
AQSTTNSFSGDMRDFFTYLESNQGLSSDLYLVDVQAGTEPFSGSNAVFTVSDYSVSVA

Enzyme Prediction     

EC	3.2.1.4:15	3.2.1.151:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	90	237	2.3e-45	0.9871794871794872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	6.58e-56	32	237	1	206	Glycosyl hydrolase family 12.
235746	PRK06215	1.09e-21	23	236	41	236	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV23011.1|GH12|3.2.1.151	2.32e-171	1	238	1	238
QBH72468.1|GH12	9.08e-169	1	238	1	238
EAW08261.1|GH12|3.2.1.151	4.05e-120	1	238	1	241
AWN00461.1|GH12	5.27e-115	1	238	1	237
BCS08101.1|GH12	9.93e-107	3	237	4	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4NPR_A	7.82e-163	18	238	23	243	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
3VL8_A	1.67e-103	11	237	3	228	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
3VLB_B	2.16e-102	20	237	5	221	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
5GM3_A	9.68e-64	21	237	2	218	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus],5GM3_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus]
5GM4_A	7.82e-63	21	237	2	218	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_C Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_D Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_E Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_F Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_G Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XNQ1|XGEA_ASPFC	1.44e-172	1	238	1	238	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xgeA PE=3 SV=1
sp|Q4WJU8|XGEA_ASPFU	4.13e-172	1	238	1	238	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xgeA PE=3 SV=1
sp|A1D4F1|XGEA_NEOFI	1.61e-169	1	238	1	238	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xgeA PE=3 SV=1
sp|A1CRJ0|XGEA_ASPCL	7.20e-121	1	238	1	241	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=xgeA PE=3 SV=1
sp|Q0CRC9|XGEA_ASPTN	3.41e-107	1	238	1	250	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xgeA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000197	0.999807	CS pos: 18-19. Pr: 0.9786

TMHMM  Annotations     

There is no transmembrane helices in AFUB_005070-T-p1.