CAZyme Information: AEO62022.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO62022.1
• CAZy Family: GT55|GT55
• CAZyme Description: glycoside hydrolase family 24 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
266		28239.59	10.0944

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003008:3203962-3204959(-)

Full Sequence      

MKFYILAALASILAPAAAYPVTANGGLSCRSGPGTSYPVKKTYKKGFDIKISCQTTGTSV
NGYNIWDKTQDGCYVSDYYVKTGKSGFVTTKCGSSGGGGSTCAAPKSNSATVDLIAKSEG
FRSKIYTDATGHATVGYGHMCTKPKCAEVKYKIPLSTADGKKLLAEDMRKFEKCITNMLN
SKAVLNYNQFGALVSWSFNVGCGAAQSSQLVKRLNKGENVNKVLSEELPKWVHGGGKVLP
GLVTRRKNEVALAKKPGSSKALPVKC

Enzyme Prediction     

No EC number prediction in AEO62022.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	109	249	2e-37	0.9781021897810219

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381599	lyz_endolysin_autolysin	2.62e-50	112	252	2	134	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381620	lyz_P1	1.67e-32	110	252	5	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
226295	RrrD	7.57e-27	109	256	9	150	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
381619	endolysin_R21-like	1.63e-23	109	252	6	140	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
395766	Phage_lysozyme	2.40e-11	125	247	1	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO62022.1|GH24	1.65e-194	1	266	1	266
AEO71812.1|GH24	4.66e-131	1	266	1	261
QKD50435.1|GH24	2.75e-120	1	266	1	259
CCT75183.1|GH24	1.87e-101	1	266	1	258
QGI87874.1|GH24	2.65e-101	1	266	1	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	2.03e-19	112	252	57	192	Chain A, Lysozyme [Acinetobacter baumannii]
7M5I_A	5.74e-11	112	249	14	149	Chain A, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]
6H9D_A	1.67e-10	106	256	5	149	Chain A, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]
2ANV_A	2.51e-08	112	215	9	109	Chain A, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P11187|ENLYS_BPPH2	2.35e-17	110	252	6	141	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
sp|P07540|ENLYS_BPPZA	4.49e-17	110	252	6	141	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
sp|Q37896|ENLYS_BPB03	1.76e-16	110	252	6	141	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
sp|Q9T1T5|ENLYS_BPAPS	1.71e-11	114	252	10	142	Endolysin OS=Acyrthosiphon pisum secondary endosymbiont phage 1 OX=2682836 GN=13 PE=3 SV=1
sp|P09963|ENLYS_BPP22	6.88e-08	112	215	9	109	Endolysin OS=Salmonella phage P22 OX=10754 GN=19 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000213	0.999763	CS pos: 18-19. Pr: 0.9800

TMHMM  Annotations     

There is no transmembrane helices in AEO62022.1.