CAZyme Information: AEO61191.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO61191.1
• CAZy Family: GT25
• CAZyme Description: glycoside hydrolase family 18 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
176	CP003007|CGC1	18741.07	7.0198

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003007:3843246-3843881(-)

Full Sequence      

DSTNKFTGSYIRPHTNLTEICEGLSLLWRAGVSPSKVVLGPGWYGCTRSSGTLSNAEIKR
VLASGAGKESYDATAGVRWLTWNTDQRVSYDDGVNVQQKIALANNLCLGCIMIWALDQDD
AKGSSKKDLLGTGPANGISEEAAESYMKQLANATLQKAVASSCYWTLCGGGCNHGL

Enzyme Prediction     

No EC number prediction in AEO61191.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	12	126	7.7e-18	0.40878378378378377

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	3.53e-13	4	119	182	307	Glycosyl hydrolases family 18.
119357	GH18_zymocin_alpha	6.97e-10	7	117	204	343	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
214753	Glyco_18	1.85e-09	30	119	222	334	Glyco_18 domain.
119351	GH18_chitolectin_chitotriosidase	2.13e-09	29	123	228	345	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
119365	GH18_chitinase	5.25e-09	29	119	247	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO61191.1|GH18	4.04e-130	1	176	1	176
QGA14464.1|GH18	8.82e-66	1	173	409	608
UKZ69007.1|CBM18|GH18	1.94e-57	1	175	384	585
UKZ96386.1|GH18	3.57e-57	1	175	49	250
UDD64969.1|GH18	2.21e-49	1	175	104	303

PDB Hits     

AEO61191.1 has no PDB hit.

Swiss-Prot Hits     

AEO61191.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000081	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AEO61191.1.