CAZyme Information: AEO60909.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO60909.1
• CAZy Family: GT2
• CAZyme Description: glycoside hydrolase family 75 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	CP003007|CGC6	32524.44	3.9875

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003007:2376068-2377349(+)

Full Sequence      

MRNQVLLSALVGAAGVAARDVPSNVQSFYDSLKAKGACSNKLATGFYANDDGPNTFAYCG
DHLSDYNVIYLKGSGSAFADMDIDCDGEQNGKGDDGRCGNSQDTQAITSFQDIVEGYKKG
VKDLNAYVHPYVVFGNTGSKSGWKTFDPQKYGIKPLSVMAVVCNNKLIYGVWGDENGDDG
DKPMVGEASISLATACFGTSMTGNNGHDETDVLYIAFPGDDAVPGADGANWGADSWQAFE
SSIEGLGNKLIQRIGGGDPGNGGGDDPGNGGDGFDDCEWPGHCEGASCSTDDDCSDPWAC
INGKCGTDPALL

Enzyme Prediction     

EC	3.2.1.132:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	8	253	1.4e-79	0.9818181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	1.83e-94	81	253	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60909.1|GH75	3.22e-215	1	312	1	312
UNI20522.1|GH75	5.98e-131	1	291	3	287
AEO66412.1|GH75	1.33e-128	9	256	5	252
BAA12799.1|GH75|3.2.1.132	1.42e-128	1	290	4	286
ABX57824.1|GH75|3.2.1.132	7.12e-128	1	290	4	282

PDB Hits     

AEO60909.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	1.95e-71	8	254	8	240	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	1.86e-61	9	251	8	240	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	1.86e-61	9	251	8	240	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q2U1H5|CSNB_ASPOR	4.18e-59	3	251	4	236	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q875I9|CSN_ASPFM	6.81e-57	3	251	4	233	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000374	0.999610	CS pos: 18-19. Pr: 0.9766

TMHMM  Annotations     

There is no transmembrane helices in AEO60909.1.