CAZyme Information: AEO60805.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO60805.1
• CAZy Family: GT2
• CAZyme Description: glycosyltransferase family 58 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446		50521.92	10.3145

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003007:1895170-1896666(+)

Full Sequence      

MTRMRSSPKTPTATMADQNRPIHIRATRLVFDILNGRHVLSKLIPPLVFLADALLCALII
WKVPYTEIDWNAYMEQVAQILSGERDYTKIRGNTGPLVYPAAHVYIYTGLYHLTDEGRNI
LTAQKLFGFLYMVTLAVVMACYWQAKVPPYVFPLLILSKRLHSIFVLRCFNDCFATLFLW
LAIFALQRRAWRTGALMYTLGLGVKMSLLLVLPAVGVVLLLGAGFATSLRLAAVIGLVQV
LIAVPFLSNNPWGYLGRAFELSRQFFFKWTVNWRFVGEEVFLSKEFSLALLGLHVAVLAI
FVTTRWLKPARKPVSQLIVPILLGKSPFTEEEQRAVSRDVTPRFILTSILSANVVGLLFA
RSLHYQFYSYLAWMTPYLLWRSGVHPILQYAIWTAQEWAWNVYPSTPISSGVVVGVLALT
AALVWLGAREDWEPRRVLLKGEAAKR

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	46	410	9.2e-154	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	46	410	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60805.1|GT58	0.0	1	446	1	446
AEO66311.1|GT58	1.38e-251	15	446	1	445
AAK07848.1|GT58	8.32e-229	17	446	9	442
VBB84570.1|GT58	5.41e-212	15	431	1	417
QBZ56825.1|GT58	1.60e-207	25	446	11	432

PDB Hits     

AEO60805.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C1K8|ALG3_NEUCR	1.48e-229	17	446	9	442	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1
sp|Q2U6A4|ALG3_ASPOR	7.48e-158	34	436	12	406	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	8.16e-144	17	425	56	455	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	3.67e-142	34	418	20	393	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	1.37e-137	34	418	12	385	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999945	0.000066

TMHMM  Annotations     

Start	End
39	61
96	113
126	144
164	186
207	229
234	256
344	363
406	428