CAZyme Information: AEO60762.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO60762.1
• CAZy Family: GT17
• CAZyme Description: carbohydrate esterase family 8 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	CP003007|CGC2	35671.24	6.4805

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003007:1662836-1663846(-)

Full Sequence      

MLSKVLGFVSLAAAAAAAPLQSRAARTSPPEGCLTVGSSGTYKTVQSAVDALSRSATSEQ
CIFIYGGTYQEQVTIPALRSALVVYGETEDTSRFSANKVTITQSRSQDDSADNDATATLR
AHTANLRVYNVNLVNTRGKGSQALALSAQADRQGYYACQFRGYQDTVLANEGAQVYARSY
VEGATDFIFGQRARAWFDAADIRVLAASKGYITANGRDSADNPSYYVIHNSAVSARSGDS
VPAGAYYLGRPWRNYARVVFQKTSLSGVVNAAGWSVWNTGDERTDEVEFGEYGNTGAGAG
ASGSRAAFAKQLSAPVSIETVLGSDYASWVDTSYLS

Enzyme Prediction     

EC	3.1.1.11:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	38	314	1.1e-75	0.9236111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	6.02e-48	39	303	9	270	Pectinesterase.
178113	PLN02497	2.42e-44	40	314	42	308	probable pectinesterase
215357	PLN02665	1.68e-39	39	313	77	341	pectinesterase family protein
178051	PLN02432	2.31e-39	40	314	21	274	putative pectinesterase
178504	PLN02916	4.31e-38	39	302	196	459	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60762.1|CE8	1.35e-235	1	336	1	336
AEO66258.1|CE8	1.36e-163	1	336	1	334
AAD51853.1|CE8|3.1.1.11	1.19e-162	9	336	9	336
QRD06953.1|CE8	5.80e-158	9	336	29	354
AAD43340.1|CE8|3.1.1.11	3.47e-141	8	336	8	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	6.83e-74	26	334	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	6.83e-74	26	334	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	4.20e-36	30	303	7	277	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	2.33e-28	40	302	13	272	Chain A, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	1.24e-10	41	323	17	335	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	4.01e-109	1	336	1	331	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	5.69e-109	24	334	18	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|A1DBT4|PMEA_NEOFI	2.13e-86	3	334	5	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	1.71e-85	3	334	5	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	1.71e-85	3	334	5	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001401	0.998577	CS pos: 23-24. Pr: 0.9484

TMHMM  Annotations     

There is no transmembrane helices in AEO60762.1.