CAZyme Information: AEO60662.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO60662.1
• CAZy Family: GT15
• CAZyme Description: glycoside hydrolase family 76 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	CP003007|CGC6	46327.98	5.1006

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003007:1186649-1187977(+)

Full Sequence      

MRFLRSLKPALATTAAIAAIAPKDLDINDPSSIKGVAKTIASGAMSYYSGTAEKFVDLPE
PYYWWQAGALMGSMLDYSHYTGDKSYDRIIATALLGQVGPNFDFMLPSHFGQEGNDDQAF
WGFAVMAAAERNFPQPDENVPSWLQLGANLWNSLASRWNTTACNGGLLWQIFASNPNGLD
YKNSVSNGGLFQISARLARATGNNTYLEWAEKVWDWTEGVGMIDKDFNVHDGASASHNCT
DINPVTFSYTAAIYMYGAAVMADVTGDKKWVQRTERILDAARSFFSPFPNATNIMYEHAC
EQVGTCNADMRSFKGYLSRFAYAASVFVPSIKPVIEELWHPTAKAAAKSCSGGPDGTQCG
QRWYYGGFDGTTGLGEEMCALETIQGLLVGEAEPPLKGDQIKTVRTFEGSSNTKRGGRYD
ARLA

Enzyme Prediction     

No EC number prediction in AEO60662.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	31	391	1.6e-96	0.9329608938547486

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.14e-165	32	381	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	7.49e-08	62	269	44	229	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60662.1|GH76	0.0	1	424	1	424
AEO70787.1|GH76	1.03e-270	1	424	1	425
VBB73902.1|GH76	9.22e-234	1	416	1	422
CDP24660.1|GH76	1.31e-233	1	416	1	422
CAP67249.1|GH76	1.31e-233	1	416	1	422

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	6.18e-98	37	395	40	410	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	6.00e-107	24	414	20	407	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	1.02e-106	25	399	21	399	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	1.98e-106	24	395	23	394	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|P36091|DCW1_YEAST	5.99e-102	24	384	23	381	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q05031|DFG5_YEAST	6.25e-98	24	423	28	440	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.711339	0.288645

TMHMM  Annotations     

There is no transmembrane helices in AEO60662.1.