CAZyme Information: AEO60554.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO60554.1
• CAZy Family: GT1
• CAZyme Description: glycosyltransferase family 35 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
741		84449.23	8.1579

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003007:434185-436766(-)

Full Sequence      

MASGKLPSRERRPSVGAPIVDIQGSVGPAGISRPKHTRVFTGFGAGEIKHVEASIPEPQR
KTWRKHQSRGFKDKDGFEREVVRHVETTLARSLFNCDEAAAYSATALAFRDRLILEWNRT
QQHQTFVGSKRVYYLSLEFLMGRALDNAMLNVGQKELAKAGLAELGFRIEDVIHQEHDAA
LGNGGLGRLAACFLDSLASLNYPAWGYGLRYRYGIFKQEIIDGYQVEVPDYWLDFNPWEF
PRHDVAVDVQFYGSVEKKTNETGRTVYHWEGGETVKAVPYDVPIPGYNTPTTNNLRLWSS
KAASGEFDFQKFNNGDYESSVADQQRAETISAVLYPNDNLDRGKELRLKQQYFWVAASLY
DIVRRFKRTKRPWNEFPDQVAIQLNDTHPTLAIVELQRILVDLEGLDWDEAWNIVVNTFG
YTNHTVLPEALEKWSVPLMQHLLPRHLQIIYDINLFFLQKVEREFPGDLELLRDVSIIEE
SQPKMIRMAYLAIVGSHKVNGVAELHSELIQATIFKDFVRIFGPDKFTNVTNGITPRRWL
HQANPRLSELIASKTGGYGFLKDLTQLNQLELHVNDKEFRKEWAEIKYANKVRLAKHIKA
TTGVTVNPTALFDVQVKRIHEYKRQQMNIFGAIHRYLKLKSMSPEERQKQLPRVSIFGGK
AAPGYWMAKQIIHLINNVGAVVNNDKDIGDLLKVVFIEDYNVSKAEMIIPASDISEHIST
AGTEYVKPCSLTRALGEWTGC

Enzyme Prediction     

EC	2.4.1.1:158

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	162	724	1.8e-223	0.7700296735905044

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395272	Phosphorylase	0.0	162	724	1	506	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.
184948	PRK14986	0.0	110	724	50	654	glycogen phosphorylase; Provisional
223136	GlgP	0.0	72	724	4	589	Glucan phosphorylase [Carbohydrate transport and metabolism].
237881	PRK14985	0.0	123	724	52	640	maltodextrin phosphorylase; Provisional
273967	P_ylase	0.0	81	724	1	638	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60554.1|GT35	0.0	1	741	1	741
AEO70908.1|GT35	0.0	1	724	1	724
VBB74050.1|GT35	0.0	1	724	1	724
CAP67393.1|GT35	0.0	1	724	1	724
CDP24807.1|GT35	0.0	1	724	1	724

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YGP_A	1.87e-309	34	724	1	720	Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae],1YGP_B Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae]
3CEH_A	1.08e-223	83	724	11	650	Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEH_B Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEJ_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEJ_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEM_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens],3CEM_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens]
1FA9_A	3.56e-223	83	724	33	672	HUMAN LIVER GLYCOGEN PHOSPHORYLASE A COMPLEXED WITH AMP [Homo sapiens]
1FC0_A	3.56e-223	83	724	33	672	HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],1FC0_B HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],2ATI_A Glycogen Phosphorylase Inhibitors [Homo sapiens],2ATI_B Glycogen Phosphorylase Inhibitors [Homo sapiens]
1XOI_A	3.56e-223	83	724	33	672	Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens],1XOI_B Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06738|PHSG_YEAST	2.82e-311	34	724	24	743	Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
sp|Q00766|PHS1_DICDI	4.44e-265	73	724	40	689	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
sp|P34114|PHS2_DICDI	3.45e-243	73	724	110	755	Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
sp|P32811|PHSH_SOLTU	3.53e-223	81	741	30	690	Alpha-glucan phosphorylase, H isozyme OS=Solanum tuberosum OX=4113 PE=1 SV=1
sp|P06737|PYGL_HUMAN	1.89e-222	83	724	34	673	Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000092	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AEO60554.1.