CAZyme Information: AEO60464.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO60464.1
• CAZy Family: GH93
• CAZyme Description: 4-O-methyl-glucuronoyl methylesterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397	CP003006|CGC16	41751.75	6.2224

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003006:1737939-1739132(-)

Full Sequence      

MVHLTSALLVAGAAFAAAAPMNHIFERQDTCSVSDNYPTVNSAKLPDPFTTASGEKVTTK
DQFECRRAEINKILQQYELGEYPGPPDSVEASLSGNSITVRVTVGSKSISFSASIRKPSG
AGPFPAIIGIGGASIPIPSNVATITFNNDEFGAQMGSGSRGQGKFYDLFGRDHSAGSLTA
WAWGVDRLIDGLEQVGAQASGIDTKRLGVTGCSRNGKGAFITGALVDRIALTIPQESGAG
GAACWRISDQQKAAGANIQTAAQIITENPWFSRNFDPHVNSITSVPQDHHLLAALIVPRG
LAVFENNIDWLGPVSTTGCMAAGRLIYKAYGVPNNMGFSLVGGHNHCQFPSSQNQDLNSY
INYFLLGQGSPSGVEHSDVNVNVAEWAPWGAGAPTLA

Enzyme Prediction     

EC	3.1.1.-:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	44	366	8.6e-84	0.9925650557620818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398147	DUF463	0.003	206	227	2	22	YcjX-like family, DUF463. These proteins possess a P-loop motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60464.1|CE15|3.1.1.-	4.82e-294	1	397	1	397
AEO68173.1|CE15	8.60e-233	1	397	1	397
VBB82012.1|CE15	2.31e-225	1	397	1	395
CDP30167.1|CE15	3.28e-225	1	397	1	395
CAP65970.1|CE15	3.28e-225	1	397	1	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4G4G_A	8.68e-284	1	397	15	411	Crystal structure of recombinant glucuronoyl esterase from Sporotrichum thermophile determined at 1.55 A resolution [Thermothelomyces thermophilus ATCC 42464]
4G4I_A	2.49e-283	1	397	15	411	Crystal structure of glucuronoyl esterase S213A mutant from Sporotrichum thermophile determined at 1.9 A resolution [Thermothelomyces thermophilus ATCC 42464],4G4J_A Crystal structure of glucuronoyl esterase S213A mutant from Sporotrichum thermophile in complex with methyl 4-O-methyl-beta-D-glucopyranuronate determined at 2.35 A resolution [Thermothelomyces thermophilus ATCC 42464]
3PIC_A	5.46e-144	30	397	10	375	Chain A, Cip2 [Trichoderma reesei],3PIC_B Chain B, Cip2 [Trichoderma reesei],3PIC_C Chain C, Cip2 [Trichoderma reesei]
6RU2_A	2.79e-115	32	396	5	379	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor],6RU2_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor]
6RTV_A	7.42e-115	32	396	11	385	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant [Cerrena unicolor],6RTV_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant [Cerrena unicolor],6RU1_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid Um4X [Cerrena unicolor],6RU1_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid Um4X [Cerrena unicolor],6RV7_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid UXXR [Cerrena unicolor],6RV7_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid UXXR [Cerrena unicolor],6RV9_A Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid XUXXR [Cerrena unicolor],6RV9_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor inactive S270A variant in complex with the aldouronic acid XUXXR [Cerrena unicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJR6|GCE2_MYCTT	8.56e-295	1	397	1	397	4-O-methyl-glucuronoyl methylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=ge2 PE=1 SV=1
sp|Q7S1X0|GCE_NEUCR	1.98e-205	1	389	1	388	4-O-methyl-glucuronoyl methylesterase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=Cip2 PE=1 SV=2
sp|G0RV93|GCE_HYPJQ	4.94e-142	30	397	95	460	4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cip2 PE=1 SV=1
sp|B2ABS0|GCE1_PODAN	2.44e-129	44	389	122	475	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
sp|A0A1D8EJG8|GCE1_SODAL	9.97e-119	44	389	142	490	4-O-methyl-glucuronoyl methylesterase 1 OS=Sodiomyces alcalophilus OX=398408 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999722	CS pos: 27-28. Pr: 0.7241

TMHMM  Annotations     

There is no transmembrane helices in AEO60464.1.