CAZyme Information: AEO60443.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO60443.1
• CAZy Family: PL1
• CAZyme Description: glycosyltransferase family 2 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
584	CP003006|CGC18	65016.11	7.0431

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003006:4263729-4265552(-)

Full Sequence      

GHRVSAFRQVLNVLGCILAVPLYYLTTAHTRYPVTLDIIITIAFTELNRYVIEGCRIAFQ
GRQRSGRDTASLSEKWDEKAAWYLENQPETPKLECLAAVVGWREDPGLYARALESYKSSK
ACVFLLAGIDGDEAEDEDMVRVFKKVYPEHSAVIDIPEPLGDIAESVRAKVIAQGRHHQD
PVSDDEVDAVAMQYCIELAKSILVQHNLRIGAPDGVRHLCLKQRHMHKKGIMFTTFVFSL
VIADILGVEFLWSSDSDTIVFPDSLEGTINTFAADPDAGGASSGLVVHNAEETTVTKLAS
AVYWGELYLTRSTPACTGTSDCQSGPSTAFRLAALPDILIPWYLQRALGKRMIVNEDRHL
TTNLLLRGWKVMFASDVLTATDTPTTMSRWLKQQVRWARATHIESLLHPRVYATSHPLLF
YGMAKREFGPAIGAIAIIWYFFTSQQLVVFSVNDLVCRVLVGSCYNILRNPDRLKGGDLL
WILPSILFYYIPLPAVHLWSMMTMGADGWGTSMRASGERARKESLRRAWFETGFFVVWMG
ILGGVVAKVLGAYLGMVWHERMAAILVSVAISSFGTWSITIGVS

Enzyme Prediction     

No EC number prediction in AEO60443.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133056	GT2_HAS	3.58e-20	220	401	57	232	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
224136	BcsA	4.04e-16	154	550	58	415	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133033	Chitin_synth_C	1.26e-07	222	397	53	237	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
367353	Chitin_synth_2	6.18e-07	255	401	209	374	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133045	CESA_like	8.97e-07	255	335	86	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60443.1|GT2	0.0	1	584	1	584
CAP73326.1|GT2	3.43e-301	1	584	18	602
CDP25729.1|GT2	3.43e-301	1	584	18	602
VBB75815.1|GT2	4.86e-301	1	584	18	602
UNI13287.1|GT2	2.93e-258	4	581	27	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	3.25e-25	99	549	89	495	Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	1.38e-24	99	549	89	495	Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92839|HYAS1_HUMAN	1.28e-25	99	514	101	493	Hyaluronan synthase 1 OS=Homo sapiens OX=9606 GN=HAS1 PE=1 SV=2
sp|Q61647|HYAS1_MOUSE	3.17e-24	99	514	105	498	Hyaluronan synthase 1 OS=Mus musculus OX=10090 GN=Has1 PE=1 SV=1
sp|P04341|NODC_RHIME	1.76e-18	275	509	159	392	N-acetylglucosaminyltransferase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=nodC PE=3 SV=1
sp|P17862|NODC_RHILO	2.32e-18	255	438	140	322	N-acetylglucosaminyltransferase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=nodC PE=3 SV=2
sp|P26024|NODC_BRADU	1.06e-16	255	436	140	320	N-acetylglucosaminyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=nodC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999996	0.000021

TMHMM  Annotations     

Start	End
4	26
230	252
428	450
479	501
535	557
564	583