CAZyme Information: AEO60260.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO60260.1
• CAZy Family: GH76
• CAZyme Description: glycosyltransferase family 24 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1488	CP003006|CGC5	168019.93	5.7769

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003006:3506814-3511280(-)

Full Sequence      

MLRLRQHSRPPLIWWSCCRSILPSNADHSSRTFRETAASENATAYFPLLNRIAQGHFLEA
TTDKALYEKFIEVLRRDGHMDGEALSTFRLGLSMRTAAPRVEAHYQYYTTAVEPSLPDDQ
DKCGQWFLVGGKQYCTPALDVAHGDVRGDAQERVLPFDRKIGTGPREIILYADITSPDFG
NFHQAALKLAQNGEGTYRVRYKRNPAQRREALSVNGYGVELALKRTDYIVIDDRDTGSGE
APPDQTPNPIGSSQVVLNEEEEITDIKPLEKSELAPLGMKAASFIMQSDAPFETLLKLTQ
DFPKYSTFLAAHNVSADFKAEHAGNRRVLLPEGVNILWMNGLQLIERQIQPFGLVELLQR
ERKLINGVLDLGLSGQQAISLLGHPEIAQARSGDEEPRRFDWRDEIEDGRVIIWLNNLEK
DKRYREFSPSIYAVIQPMGHGLPQIRKDIFNLVVPVDFTKPEDVEMVTTQLLGFVRRLIP
IRFGLVPLTPTGEAIEQAKVVYYLLENHGLSAVVSYLEKSLEQRKTARPDQNILLEAIKD
RPLRPEASPLPFNDIFTSETHEKQIHLAKHWVERLRAGGEIPSVFLNGFAIPRDEHWVKV
MNQKLMVDLQALQHAAYFGQINDNVWVPGMFLENAVARRNSLIFPEDATDLKVLNVKKIY
TEHHDVLSKVPIIEADDQSIKADWAALTVITDLDSLDGQKLLYFALQFRRDQPGVRVDIV
HNPKDVTRSASQLNQRIKARESELSAVSRLLDLETILQSGEAQADPGYDAALAAFLATAK
LQAGDNALILNGRVVGPIQSAEDFSKEDFDQLLSAERASRILPVHKAVEDLGLDDKISGP
LDAAKVTSVTALSGISDLPQGIFGSAPSLRTTAFNKLNSTHTSFEVGDPSRATIFLVAII
NPASEVGQKWAPVLKVLSELEGVHLKIFLNPIEELGELPVKRFYRYVLESAPSFDEHGKV
KALSANFAGVPLDTLLVAGMDVPPAWLVAPKVSVDDLDNLRIKDIKTRRGTEHIEAVYEL
ESILIEGHSREMPAGRPPRGVQLVLGTERDPHFADTIIMANLGYFQFKASPGVYNLRLKE
GRSSDIFSMESAGAQGWTPVPGDNTTEIVLMDFQGTTLYPRLKRKPGMEAEDVLEESSAN
AGTGSAMEYVSKGLKFAEGLFGRAKSTPETKSLSATQHADINIFSVASGHLYERMLNIMM
VSVMRHTNHTVKFWFIEQFLSPSFKNSIPHLAAHYNFTYEMVTYKWPHWLRQQKEKQREI
WGYKILFLDVLFPLSLDKVIFVDADQIVRTDMYDLVTHDLHGAPYGFTPMCDSRTEMEGF
RFWKTGYWANYLRGLPYHISALYVVDLRRFRELAAGDRLRQQYHTLSADPHSLANLDQDL
PNHMQFQIPIHSLPQEWLWCETWCSDETLEEARTIDLCNNPQTKEPKLDRARRQVPEWTE
YDEEIAALLKRRREEQQEQQAGEVEKNTKSRKFEEDRATETTSVKDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1181	1428	5.3e-133	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1181	1448	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	0.0	1181	1428	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	9.10e-96	400	643	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	2.34e-67	1026	1135	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.
408202	Thioredoxin_15	5.73e-66	655	851	1	204	Thioredoxin-like domain. This is the fourth TRXL(thioredoxin-like) domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60260.1|GT24	0.0	1	1488	1	1488
AEO67685.1|GT24	0.0	35	1448	51	1465
CDP29610.1|GT24	0.0	35	1476	49	1484
CAP49306.1|GT24	0.0	35	1476	49	1484
CAD60785.1|GT24	0.0	35	1476	49	1484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	35	1448	30	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	35	1448	30	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	0.0	35	1448	30	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	35	1448	30	1213	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	0.0	35	1390	23	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	3.99e-260	25	1448	31	1424	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	1.23e-221	88	1448	118	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	1.40e-216	62	1448	94	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	3.82e-216	62	1448	94	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q09332|UGGG_DROME	6.95e-216	59	1448	75	1507	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000001

TMHMM  Annotations     

There is no transmembrane helices in AEO60260.1.