CAZyme Information: AEO60130.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO60130.1
• CAZy Family: GH76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611	CP003006|CGC13	65585.04	4.8916

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003006:3063050-3064951(-)

Full Sequence      

MMASVDLDQPFDYIVVGGGTAGLVVANRLSEDSNVRVLVVEAGADRNADPLVLTPGLVAG
LYGKDEYDWNFSSPPQPTLNNRRINQARGKMLGGTSGLNFMMLLYPSKGNIDSWAALGNP
SWNYDALAPYLRKFATVHPSPQSARDLLGLTYIDESLAAGDGPIQVSHTDGHNVTNKAWL
ETFASLGLEVSTDPRDGKALGAFQNHASIDPATHTRSFAGPAYYTPDVAKRPNLVVLTET
LVARVLFDTAGGEGDAVATGVEIITKDGQKKQVSACGEVILAAGALQSPQILELSGVGGR
ELLEKHNIPVVVDNPNVGEHVQDHPIVCQSFEVADGVPSGDVLRDPNVLQAVVGMYQSGG
GAGPLGQSVISVAYTPLVDGSGVVSAEAKAELLARHESSFSTAEGKVLRDLVESPSEATF
EFLLFPSQVDIPENPTSMAQYITPVLPENYISVMTFIHQPFSRGKVHITSPDIRAAPLWD
PRYNSDPLDLELLARGVQFVERIVDSATPFGRVLKQGGKRQPPLRADDLETAREIVRQRQ
ISVFHVSGSCTMRPRDQGGVVDERLRVYGTRGLRVVDASVFPIEPVGNIQSVVYAVAERA
ADLIKEDRAKA

Enzyme Prediction     

No EC number prediction in AEO60130.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	10	607	3.5e-178	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.28e-90	11	605	6	532	choline dehydrogenase; Validated
225186	BetA	4.59e-86	4	611	1	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	6.83e-35	460	600	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.10e-28	8	593	53	565	Protein HOTHEAD
366272	GMC_oxred_N	3.36e-28	77	326	12	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60130.1|AA3_2	0.0	1	611	1	611
CAD60572.1|AA3_2	0.0	2	608	1	605
CDP29465.1|AA3_2	0.0	2	608	1	605
VBB81258.1|AA3_2	0.0	2	608	1	605
UKZ60559.1|AA3_2	5.43e-267	9	608	6	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	2.37e-75	11	607	6	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.79e-67	11	607	6	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	1.88e-67	7	607	32	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
3Q9T_A	1.74e-65	11	607	7	572	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.74e-65	11	607	7	572	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A142PTM2|CITC_MONPU	3.86e-99	7	607	10	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	3.86e-99	7	607	10	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	5.02e-95	7	607	10	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	6.73e-85	12	607	41	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	5.57e-80	6	604	41	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000006

TMHMM  Annotations     

There is no transmembrane helices in AEO60130.1.