CAZyme Information: AEO59519.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO59519.1
• CAZy Family: GH55
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
225		23818.69	8.3423

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003006:134502-135295(-)

Full Sequence      

MRTAIANVFSFCLVLLLGSLRGGHAFATAPAPALDKRQSTSRYCSPSTQICYLEYSWGPT
IPVFRIAVPDSASTNTDFQTLLQIVAPASLGWAGFSWGGGMTLNPLTVAWPNGSGGATVS
SRWATGRSLPTVYSSATYRIISAETNSTHWTVETVCSGCSRWNGSALSTTAVNTFAWAVS
KSPVSQPADSSSSFQIHDNIGTFAASLNDAKVPKATFDQYVQGAQ

Enzyme Prediction     

No EC number prediction in AEO59519.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA8	43	214	3.6e-49	0.9725274725274725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	1.21e-55	43	214	1	177	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
187688	CDH_like_cytochrome	1.27e-49	43	203	2	164	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
187689	DOMON_DOH	0.005	91	183	31	125	DOMON-like domain of copper-dependent monooxygenases and related proteins. This diverse family characterizes DOMON domains found in dopamine beta-hydroxylase (DBH), monooxygenase X (MOX), and various other proteins, some of which contain DOMON domains exclusively; the family is not restricted to eukaryotes. DBH is a membrane-bound enzyme that converts dopamine to L-norepinephrine, and plays a central role in the metabolism of catecholamine neurotransmitters. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO59519.1|AA8	2.42e-162	1	225	1	225
AEO69821.1|AA8	3.84e-103	4	225	3	231
VBB71295.1|AA8	9.64e-63	30	222	23	229
CDP22306.1|AA8	4.18e-57	30	222	23	221
VBB73733.1|AA8	1.60e-48	23	218	12	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1D7C_A	7.14e-21	39	223	2	187	Chain A, CELLOBIOSE DEHYDROGENASE [Phanerodontia chrysosporium],1D7C_B Chain B, CELLOBIOSE DEHYDROGENASE [Phanerodontia chrysosporium]
1D7B_A	4.91e-20	39	221	2	185	Chain A, CELLOBIOSE DEHYDROGENASE [Phanerodontia chrysosporium],1D7B_B Chain B, CELLOBIOSE DEHYDROGENASE [Phanerodontia chrysosporium],1D7D_A Chain A, CELLOBIOSE DEHYDROGENASE [Phanerodontia chrysosporium],1D7D_B Chain B, CELLOBIOSE DEHYDROGENASE [Phanerodontia chrysosporium]
1PL3_A	5.14e-19	39	221	2	185	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1PL3_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
6JT6_A	1.86e-15	56	222	27	187	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	4.29e-20	22	223	3	205	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000218	0.999753	CS pos: 25-26. Pr: 0.9722

TMHMM  Annotations     

Start	End
5	27