CAZyme Information: AEO59370.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO59370.1
• CAZy Family: GH5
• CAZyme Description: carbohydrate esterase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235		25723.29	5.1822

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003005:4105354-4106226(+)

Full Sequence      

MHILSFVSAFSLASLALASPVEVAERQAQKLRIMPLGDSITEITCWRAFVWDQLAAAGLA
DQVQYVGSQNSNPQGCQPQTANWDQHHEGHSGWLAIDIANNYLANWLRSTPADIVMFMLG
TNDVVRGHTTDEIINAYTKMVEIMRAANPNTKIIVDLVIPLPFSNGPIQAINSRIPQWAA
GLNSTESPIVVADCYQGFTSSMLRDGVHPNLEGDRLIASRVGPLLLDYVKQSLGQ

Enzyme Prediction     

No EC number prediction in AEO59370.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	31	219	4.5e-54	0.9639175257731959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.34e-44	31	218	1	150	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	3.73e-18	36	216	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	3.11e-14	36	224	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238872	SGNH_hydrolase_like_2	4.72e-11	32	218	3	185	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238866	sialate_O-acetylesterase_like2	5.84e-11	109	225	46	168	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO59370.1|CE3	1.77e-169	1	235	1	235
AEO64701.1|CE3	8.28e-127	1	233	1	234
VBB79507.1|CE3	2.26e-119	4	233	62	291
CDP27869.1|CE3	2.26e-119	4	233	62	291
CAP61514.1|CE3	2.26e-119	4	233	62	291

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	7.40e-70	31	230	2	204	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	2.11e-69	31	230	2	204	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	2.55e-08	9	213	22	248	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999743	CS pos: 26-27. Pr: 0.7604

TMHMM  Annotations     

There is no transmembrane helices in AEO59370.1.