CAZyme Information: AEO59312.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO59312.1
• CAZy Family: GH47
• CAZyme Description: glycosyltransferase family 69 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	CP003005|CGC33	40571.94	4.7507

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003005:3904168-3905259(+)

Full Sequence      

MNPDATDLPRMECPKLDSSRYKQLQETGGDQGIRYFFALDLRQCLAILPRLLGSVVEAIR
FLGPEKCALSIVEGNSDDGTSEVLAALRPELEALGLLAYHFNTSPINPKKGNRIQALATL
RNLALQPLLDRYYTNPKQSSPPPPPTPPPTVIFLNDVAICPEDILELAHQRRALGADMVC
AMDWTYVGQDPTFYDVWVARGLTGDSFFEIPPDGSWDLAWNLFWNDPGARARLAARRPFQ
VFSCWNGAAAFSAAPLVDDQSSVRFRAPREGECFQGEPQLFCKDLWFHGYRKIAVVPAVN
LEYSDDAGRRIKEAKGYASTWVGAPGWEDDSIEWRNDPPEGVKCIPAYDKQFFEAWNKTQ
PGT

Enzyme Prediction     

No EC number prediction in AEO59312.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	34	286	1.6e-70	0.9916317991631799

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	5.51e-96	34	281	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO59312.1|GT69	7.38e-274	1	363	1	363
AEO64631.1|GT69	1.50e-200	1	363	80	442
VBB79635.1|GT69	1.52e-186	1	363	1	355
CAP61615.1|GT69	8.76e-186	1	363	1	355
CDP27968.1|GT69	8.76e-186	1	363	1	355

PDB Hits     

AEO59312.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	6.34e-52	3	346	98	443	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AEO59312.1.