CAZyme Information: AEO58968.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO58968.1
• CAZy Family: GH43
• CAZyme Description: glycoside hydrolase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
927	CP003005|CGC16	100935.11	7.3011

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003005:2443039-2446311(-)

Full Sequence      

MSTLDGDLDPLWQDLDWAIGQMLIMGWDGTEVTPQIRTLIEQHHLGSVLLTAKNLKSAEQ
TARLVQELQTIARQAGHPYPLLIALDQENGGVNSLFDEDYICQFPSSMGQAAASSADLAY
KIAKATATEVSAVGVNLILGPVLDVLTNARYQPLGVRATGDDPQEVSQYGIAAMNGYKDA
GVATCGKHFPSYGNLDFLGSSLDIPIITQTLEELSLSALVPFRNAIATGKLDAMFVGGCG
IANPSMNVNHACLSEQVVDDLLRNELGFQGVAISECLEMEGLRNEIGVKTGTVMAVEAGC
DLVMLCRAYDVQLEAISGLKLGVENELITKERIYTSLRRIVRMKKSCTSWQKALNPPGIS
LLSKIHPGHLALSLKAYDDSIAVIRDNEKLLPLTSSMHQEEELLLLTPLVRPLPASSMTK
ALLEKKQIDPVTLHDKWVHRDRGAIMSGEGVFRELGRSLARARHGKLLHTSYTANGVRPV
HENLINRASCIIIVTADANRNLYQAGFTKHVSMMCSLLRANGQKKSLIVVAVSSPYDFAM
DKSVGTYICTFDFTETAMAALVRVLCGKIKPRGTLPGTLRKSRKVLKSRQHWLVEPYDRD
RDAKGLQDLLQSLARASAPAHQFLQTTSAHSFELFSPNIEEAHFVVRNSSTQALYGFCAT
YFVQGTGIIGALFVDPAKRNVSIGRSLQRRALRGLTQKRGIKKVQLGMSFPGVFLGIPAD
DSAGLKQWFTNGGWDLQFPRRLVNMAVSSLNSWIAPEGLLQSIQRAGITFDLIHGLDNAD
NVLAHVSAHASPEVLELYRFALQETKSCGVVRAKGHAEALLGTVIVCKPGSTLASFIPPL
QPSPARPDEPVGGIVSPIVAPSSAQATLVLQGLALMGLRQNKTHKSLKSVLSWVQDDAHE
PLLAMGFEVVQVFEEFTNSPDNWQDFS

Enzyme Prediction     

No EC number prediction in AEO58968.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	77	304	4.3e-49	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	8.30e-68	19	394	7	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	4.08e-55	15	343	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	8.23e-39	22	352	3	315	beta-hexosaminidase; Provisional
185053	PRK15098	1.92e-09	103	344	119	353	beta-glucosidase BglX.
178629	PLN03080	8.92e-05	104	276	114	298	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO58968.1|GH3	0.0	1	927	1	927
AEO64229.1|GH3	0.0	1	922	1	925
VBB79973.1|GH3	0.0	1	922	1	919
UQC73624.1|GH3	0.0	7	922	108	1023
QBZ62649.1|GH3	0.0	1	925	1	946

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	6.00e-87	14	773	8	716	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	5.96e-57	15	579	13	531	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	4.41e-38	15	576	44	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	6.08e-38	15	576	18	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	8.32e-38	15	576	48	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	2.27e-37	15	576	44	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	1.21e-31	30	579	49	596	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	1.38e-29	23	319	6	296	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|Q82SJ8|NAGZ_NITEU	2.04e-29	23	319	6	296	Beta-hexosaminidase OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=nagZ PE=3 SV=1
sp|B4SRK3|NAGZ_STRM5	5.28e-29	22	322	1	296	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AEO58968.1.