CAZyme Information: AEO58874.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO58874.1
• CAZy Family: GH31
• CAZyme Description: glycoside hydrolase family 47 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
521		57759.27	4.5657

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003005:2104523-2106486(-)

Full Sequence      

MRGLSVAGASAAASPLLLGLAAAAPHKQRAPQYVVNKQRADEVKEAFQVSWDGYYKYAFP
HDSLRPVSNTFADDRNGWGASAVDALSTALVMENWDVVNQILEYIPTINFDNTTTEVSLF
ETTIRYLGGLVSAYDIITNSLSLGIQKQPDVEAILTQAKRLADNLKVAFDTPSGVPDNSL
YFNPPRKGGSTTNGLATTGTLILEWTRLSDLTGDSEYAELTQKAESYLLHPEPALGEPFP
GLLGTNIRIEDGKFEDGNGSWGGGTDSFYEYLIKMYIYDPERFAEYRDRWIAAADSSIKY
LVSHPTTRPELTFLALWRGKELRFSSQHLACFHGGNFILGGLTLGEQAYTDLGLALVEGC
HATYVGTATGIGPEVFAWQDSQLPLNASNNQPPPEDQTAFYEKSGFWITNGHYVLRPEVI
ESYYYAYRATGDTKYQDWAWDAFQRINKTCRVGSGFSSIKDVNAPDGGGFDDFQESFWFA
EVLKYSYLIHAEDAPWQVKADNTNEYVWNTEAHPIRVAGGK

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	46	517	1.5e-136	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	46	517	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	6.94e-115	36	518	69	519	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO58874.1|GH47	0.0	1	521	1	521
AEO64117.1|GH47	3.09e-306	1	521	1	523
CAP66683.1|GH47	5.68e-267	29	521	53	547
CDP28418.1|GH47	5.68e-267	29	521	53	547
VBB80036.1|GH47	6.35e-266	29	521	52	546

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	1.14e-209	36	518	2	474	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	4.08e-209	36	518	37	509	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	1.97e-190	36	517	12	492	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	1.00e-66	27	517	10	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	1.25e-66	27	517	8	465	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0D076|MNS1B_ASPTN	7.51e-213	37	517	37	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|A1CP08|MNS1B_ASPCL	2.58e-209	39	517	35	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|Q12563|MNS1B_ASPPH	1.59e-208	37	518	40	511	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|P31723|MAN12_PENCI	2.10e-208	36	518	37	509	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|A2QAS2|MNS1B_ASPNC	2.25e-208	37	518	40	511	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.292412	0.707574	CS pos: 23-24. Pr: 0.5964

TMHMM  Annotations     

There is no transmembrane helices in AEO58874.1.