CAZyme Information: AEO58499.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO58499.1
• CAZy Family: GT8
• CAZyme Description: glycosyltransferase family 31 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569	CP003005|CGC11	64245.14	5.7908

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003005:387173-388882(-)

Full Sequence      

MMGLGVAKHRNRCFSMRNTFTRAVVLTIAMLAVGGVVLRSDVDVQSAIAKTAASAREAMS
LQKPLGHPESAGWGGPVDHPPKQEEQDEKNVTAEDSKPTPSSSSRVMTCDYDMDRLRRWQ
QQFGLQETFEYTKRYIQASRQDIPRRSITRLQQDFLVDAVKVVDVNKEYEAETCPEPLLA
PVTKSPYPATANGSDFMFGVSTTYQRFTDPRTSPINEWSYWLTDGKGNSNGGKLVLLLVD
AQPEELEDAYNKLSSVGIDVDVYRSSSSLIMAVRYLALAPTLYNHPERPRRKWLVVCDDD
TFFPSFHALADRFAQYDHERPMYIGTFSEDVNNIERHGPQAFGGAGVFLSRPMAKIIAEN
FENCSSEQKIQESNTGWGPQGDIMLRNCIYQNSEVKLTLLNDLWQLDIMGDPSGFYESGI
KPLSLHHYRGGIWHLARPFQYTKVAHACGEDCTFQRFQTADGFIISNGYSVAYYPRGIDF
DLNQFERTFRAAPEDKGWNLDFRMGPQRPSLHNTGRKIAWELLEATVNPDGSVSQVYVGK
HNDSRWTNPDGTPMNNRDGIIEIVWLPEA

Enzyme Prediction     

No EC number prediction in AEO58499.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398362	DUF604	4.28e-07	340	427	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
215605	PLN03153	5.22e-06	289	427	209	341	hypothetical protein; Provisional
367085	Fringe	6.43e-05	280	354	74	156	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO58499.1|GT31	0.0	1	569	1	569
AEO68470.1|GT31	3.66e-307	5	568	3	549
CDP29100.1|GT31	1.03e-262	11	566	44	596
VBB80845.1|GT31	4.15e-262	11	566	44	596
QVM79322.1|GT31	3.41e-217	11	567	9	550

PDB Hits     

AEO58499.1 has no PDB hit.

Swiss-Prot Hits     

AEO58499.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.868395	0.131616

TMHMM  Annotations     

Start	End
20	38