CAZyme Information: AEO58247.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO58247.1
• CAZy Family: GH18
• CAZyme Description: carbohydrate esterase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313		33645.84	6.9363

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003004:4383828-4384879(-)

Full Sequence      

MKLLSQLSAALALAGGRLAVAHPVFDELMRPTAPLVRPRAALQQVTNFGSNPSNTKMFIY
VPDKLAPNPPIIVAIHYCTGTAQAYYSGSPYARLADQKGFIVIYPESPYSGTCWDVSSRA
ALTHNGGGDSNSIANMVTYTLEKYNGDASKVFVTGSSSGAMMTNVMAAAYPELFAAGIAY
SGVPAGCFYSQSGGTNAWNSSCANGQINSTPQVWAKMVFDMYPEYDGPRPKMQIYHGSAD
GTLRPSNYNETIKQWCGVFGFDYTRPDTTQANSPQAGYTTYTWGEQQLVGIYAQGVGHTV
PIRGSDDMAFFGL

Enzyme Prediction     

EC	3.1.1.72:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	53	283	1.5e-23	0.9074889867841409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	2.31e-40	57	269	1	208	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	3.63e-23	28	301	7	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	2.45e-21	59	254	5	194	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
224423	DAP2	1.80e-08	58	183	381	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
395257	Peptidase_S9	3.34e-08	94	183	10	98	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO58247.1|CE1	3.06e-234	1	313	1	313
ADZ98864.1|CE1|3.1.1.72	2.32e-229	1	313	1	313
AEO67255.1|CE1	1.89e-180	29	313	1	284
CDP26566.1|CE1	7.47e-163	1	313	1	299
CAP61115.1|CE1	7.47e-163	1	313	1	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.96e-132	41	313	3	274	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WBW4|AXE1_ASPFU	1.40e-142	18	313	16	304	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1
sp|A1DBP9|AXE1_NEOFI	7.25e-142	18	313	16	304	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1
sp|A1CSZ8|AXE1_ASPCL	4.00e-139	38	313	31	306	Probable acetylxylan esterase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=axeA PE=3 SV=1
sp|B8NBI2|AXE1_ASPFN	4.23e-136	38	313	30	305	Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=axeA PE=3 SV=1
sp|Q8NJP6|AXE1_TALPU	6.87e-136	41	313	36	307	Acetylxylan esterase A OS=Talaromyces purpureogenus OX=1266744 GN=axeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.006007	0.993971	CS pos: 21-22. Pr: 0.9177

TMHMM  Annotations     

There is no transmembrane helices in AEO58247.1.