CAZyme Information: AEO57845.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO57845.1
• CAZy Family: GH16
• CAZyme Description: glycosyltransferase family 22 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
521	CP003004|CGC17	59488.62	10.1182

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003004:2529405-2531275(+)

Full Sequence      

MWRRTYLFLVLVRLWFALSPSYLHPDENLQGPEVIAGEIFRYPVRRTWEFTSDNPIRSVF
PLWPVYGLPMLLLRWLWIGNGKDGEIPPIAVFWTLRVLMFIVSFVLEDWALHELIPSQRQ
RRVAVLLVASSYVTWTFQTHTFSNSIETLVVAWSLVLIERIVASPQRGSVLASTVLGIVA
VFGVFNRITFPAFLLIPGLRLLPYYWKNPLSFVAIVTAGICTTALAITLDTAFYSPHSIS
WSDLLRNPVLTPLNNLRYNISPANLAKHGLHPWYQHLLVNLPQLLGPATVLLFTRPKRSS
RLYSAISGIAVLSLSQHQEARFLLPTVPLILSSVRLPRSEKAMRAWVASWIVFNVIFGTL
MGVYHQGGIVPAQVFMSKQPDATEAVWWKTYMPPIWLLNGKNEVLRTRDVMGMKGETLLE
ELQQLATCDTPADRRSMEYLKEKNGTYLVAPLSATWLDPYLPNKGLEGLRFREVWRYQQH
LNLDDLDFAEDGVWNTLSRVIGRRGLAIWRVTKSCPGVRGR

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	5	397	2.8e-79	0.9897172236503856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	3.79e-52	5	396	2	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	3.19e-06	3	379	39	426	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO57845.1|GT22	0.0	1	521	1	521
UNI14407.1|GT22	0.0	1	515	1	515
QPH02021.1|GT22	9.32e-315	1	516	1	516
UQC77828.1|GT22	1.04e-313	1	515	1	515
QLI65346.1|GT22	1.52e-312	1	515	1	515

PDB Hits     

AEO57845.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	7.47e-312	1	516	1	516	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q4WTT7|SMP3_ASPFU	1.73e-186	1	509	1	539	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	6.09e-186	1	514	1	540	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q5BAX7|SMP3_EMENI	2.65e-175	1	519	1	542	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	1.11e-99	10	490	13	498	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.011940	0.988020	CS pos: 23-24. Pr: 0.7366

TMHMM  Annotations     

Start	End
56	78
93	115
168	190
210	229
346	368