CAZyme Information: AEO57324.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO57324.1
• CAZy Family: GT90
• CAZyme Description: glycoside hydrolase family 17 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405	CP003004|CGC8	42755.39	4.6024

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003004:599234-600451(-)

Full Sequence      

MRPTSALVAAGVLVSGTSAENYLGFNSGATLADRSAKFKADWLAEFKTAQNLENAPGKFN
AVRLYTNIQAYSEDTPIEAFEAAIETNTKILLGIWTSGTNSIEKELSALKKAIDKYGSKF
TDLVIGMSIGSEDLYRDSETGVKNEAGIGAGPDTLIKFINDYKKAVAGTALKGVPIGHVD
TWDAWTNGTNKAVIDAVDWIGVDEYPYYENGKGNNIKNSGTLFDRAFNAVKGVAGDKPIW
VTETGWPSSGPNWDQAVSSVENAKYYWDEVGCRKLFNKVPTFWYNLRDSNPDNKMKFAIT
NNLSTKPLFDLTCPTKFDTPTSTSTSAAPSSTGVSAPSSSATSASGSTNTTGGSGTSAGA
DNSAAESGDGTEEADAIPTGSGASIGRSLFTVVSLALVAGVFTLF

Enzyme Prediction     

No EC number prediction in AEO57324.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	8.99e-28	15	272	38	267	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	6.10e-09	179	290	157	283	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO57324.1|GH17	1.67e-257	1	405	1	405
AEO69666.1|GH17	3.56e-196	1	323	1	323
CDP32718.1|GH17	2.86e-193	1	405	1	405
CAP65657.1|GH17	2.86e-193	1	405	1	405
VBB87201.1|GH17	2.86e-193	1	405	1	405

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	3.40e-19	52	288	52	268	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.16e-18	52	288	52	268	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QH21|EGLC_ASPNC	8.82e-102	6	313	4	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglC PE=3 SV=2
sp|Q2UUZ1|EGLC_ASPOR	2.72e-101	17	313	15	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q5AUT0|EGLC_EMENI	2.89e-101	24	313	23	311	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1
sp|Q4WG16|EGLC_ASPFU	2.33e-98	13	313	11	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	2.63e-98	13	313	11	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.007160	0.992811	CS pos: 19-20. Pr: 0.9432

TMHMM  Annotations     

There is no transmembrane helices in AEO57324.1.