CAZyme Information: AEO57250.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO57250.1
• CAZy Family: GH13|CBM20
• CAZyme Description: glycosyltransferase family 55 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638	CP003004|CGC9	67466.14	8.2558

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003004:305641-307557(+)

Full Sequence      

MSVTVLTSPPPPPVRYPSLAWPEIPPLRQIPGLASAKSSPAAFSAPDENRIKPHHTTAAV
SAATTTAATTTTATTTRGASMRLTRPSESRSFGLLHIAGEAQVVDLDAPGPQGGRSQGHG
GVSGQTEAGGTATVCCSREALDAVLSDMVIVVPCKDEELAVIRGVISAIPALCLVILVSN
CARGEGDEYAQQVAMARAFGRAGRQVLTVHQRDPAAAAALRAAGMEELCESGADGGGAVI
RNGKGEGMVLGIALAAAFCPGRRYIGFVDADNLCAASVTEYCRVFAAGFAMSPPPERGDC
MVRLRWRSKPKVRNGRVEFVSEGRCSRVVNSWLSRLFAAPATKEDNNTDNNSNSNSNSNN
NNNNNNNNNNNNNNNNNNNNNNNNNSNSTMKNMRAAPGTGPDTHFITTGNAGEHAMTIGL
ALKLRMAAGYAIEPFHFVDLLERAHLSAPSGGGSKASEETPGGRNDKNNNNNNGSGSDGS
SNGNNNSRSHPHPHPRKPLSRPVRVLQIRTLSPHYHRPSDGEHIRRMWAAGLGSVFHGLA
AHAGGELLPGPDGAPDGAADGAAMAISELRRDMHDFAVRQANVDRATGELPCPRTYPALE
TIDLDKFRDLMLRHSLGRGSLRSFGWPADKDHPAWAQS

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT55	128	346	8.5e-77	0.5456919060052219
GT55	394	610	3.9e-38	0.3733681462140992

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
401440	Osmo_MPGsynth	4.44e-151	85	611	1	380	Mannosyl-3-phosphoglycerate synthase (osmo_MPGsynth). This family consists of examples of mannosyl-3-phosphoglycerate synthase (MPGS), which together with mannosyl-3-phosphoglycerate phosphatase (MPGP) EC:2.4.1.217, comprises a two-step pathway for mannosylglycerate biosynthesis. Mannosylglycerate is a compatible solute that tends to be restricted to extreme thermophiles of archaea and bacteria. Note that in Rhodothermus marinus, this pathway is one of two; the other is condensation of GDP-mannose with D-glycerate by mannosylglycerate synthase.
237735	PRK14503	4.19e-83	81	615	1	385	mannosyl-3-phosphoglycerate synthase; Provisional
184713	PRK14502	4.15e-48	81	537	1	336	bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO57250.1|GT55	0.0	1	638	1	638
AEO69746.1|GT55	1.27e-133	1	617	1	533
CAP65753.1|GT55	1.36e-84	81	638	1	460
CDP32812.1|GT55	1.36e-84	81	638	1	460
VBB87296.1|GT55	7.38e-84	81	611	1	435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WVK_A	2.28e-40	81	614	1	384	Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 apoprotein [Thermus thermophilus HB27],2WVK_B Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 apoprotein [Thermus thermophilus HB27],2WVL_A Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 in complex with GDP-alpha-D-Mannose and Mg(II) [Thermus thermophilus HB27],2WVL_B Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 in complex with GDP-alpha-D-Mannose and Mg(II) [Thermus thermophilus HB27]
2WVM_A	5.36e-39	81	614	1	384	H309A mutant of Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 in complex with GDP-alpha-D-Mannose and Mg(II) [Thermus thermophilus HB27],2WVM_B H309A mutant of Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 in complex with GDP-alpha-D-Mannose and Mg(II) [Thermus thermophilus HB27]
2ZU7_A	3.36e-37	138	541	43	337	Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU7_B Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU8_A Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU8_B Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU9_A Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU9_B Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UZC1|MPGS_PYRAB	3.19e-43	138	541	43	337	Mannosyl-3-phosphoglycerate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=mngA PE=3 SV=1
sp|Q8U380|MPGS_PYRFU	6.05e-43	138	541	43	337	Mannosyl-3-phosphoglycerate synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=mngA PE=3 SV=1
sp|O58689|MPGS_PYRHO	2.99e-42	138	541	43	337	Mannosyl-3-phosphoglycerate synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=mngA PE=1 SV=1
sp|Q9YDM5|MPGS_AERPE	6.22e-27	81	541	1	335	Mannosyl-3-phosphoglycerate synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) OX=272557 GN=mngA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AEO57250.1.