CAZyme Information: AEO57203.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO57203.1
• CAZy Family: GH132
• CAZyme Description: ferulic acid esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294	CP003003|CGC3	31345.58	7.0169

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003003:5187635-5188715(+)

Full Sequence      

MRLLRSLTKMAAMAGLAAGASLQPVTNFGDNPTGLQMYVYVPDKVAVLPAIIVALHPCGG
SAQGWYSQTRLPSYADQLGFILIYAGTTKMSNCWDVQNPASLTHNGGGDAGGIVSMVKYA
LKQYNGDASRVYVMGGSSGAMMTNVLAGSYPDVFEAGAAFSGVAHACFLGADSATPFSPN
QTCAQGRIQRSAREWGDLVRNSFPAYDGRRPRMQIFHGNADFLVRPECAHQALAQWADVL
GLQLTQTNKGVPSAEYTQEVYGDGTQLQGFFGDGVGHIAPVNEPVMLRFFGLMN

Enzyme Prediction     

No EC number prediction in AEO57203.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	36	242	1.8e-23	0.8281938325991189

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	5.06e-39	37	247	1	205	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
402228	Esterase_phd	5.70e-20	40	235	6	194	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
226040	LpqC	1.40e-18	28	280	40	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
395257	Peptidase_S9	2.08e-09	72	240	7	170	Prolyl oligopeptidase family.
224423	DAP2	5.73e-08	38	163	381	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO57203.1|CE1	5.00e-219	1	294	1	294
API68922.1|CE1	2.38e-217	1	294	1	294
AFU88756.1|CE1	1.86e-154	3	294	2	292
QBZ57428.1|CE1	7.21e-152	6	293	5	291
VBB78227.1|CE1	3.08e-146	5	293	4	291

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	3.50e-76	21	291	3	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HGR3|FAEB_NEUCR	1.34e-140	5	294	4	292	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|G2QND5|FAEB_MYCTT	1.84e-140	3	293	2	291	Feruloyl esterase B OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Fae1a PE=1 SV=1
sp|Q9HE18|FAEB_TALFU	9.95e-99	10	294	9	293	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|B8M9H9|FAEB_TALSN	1.34e-97	20	292	19	291	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q96W96|AXE1_ASPFI	5.15e-79	3	291	13	301	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.496451	0.503556	CS pos: 19-20. Pr: 0.4469

TMHMM  Annotations     

There is no transmembrane helices in AEO57203.1.