CAZyme Information: AEO57054.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO57054.1
• CAZy Family: GH13
• CAZyme Description: glycosyltransferase family 8 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445		48273.23	5.4509

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003003:4976749-4978375(-)

Full Sequence      

MSAHEKVVASDKIWASLITKDSYLPGLLTLAFSLRRVGSKYPLVALHTGTLADDTVRALA
ERGIPLQRVPYIFPGTPPPQAGAVVGTDGRNGAAAKRGGSAVADREADDDDDGGSSNSTT
TTTTTTTTTTTTTTTTTTNGNSTNGGGSGSRNGWYAHDPRFRDCFTKLAAFSLAAYSRIV
LLDADMLVRRNMDELFDLPLDNENRLFAATHACTCNPLHFAHYPRDWTPDHCAFTQQHAD
PAGAQTSGGSPDDGMGQLNGGLLVLAPSSSSSSAGGVDIYRAVLDALCGPEPTPPERLPF
ADQSLLGLLFAGRWVALPYVYNALWPMRRRGVHRAIWRDAEVRNVHYILTPKPWEKKQKK
KEEETKVKAKAVDRQEKQNGGDDDDGAPNGRQARTGRDDGGDGDHHTDDADGTDDDDDVL
DRWWWEVDAERRAWEAKNGIGEQRG

Enzyme Prediction     

No EC number prediction in AEO57054.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	158	357	8.1e-28	0.5758754863813229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	1.40e-41	14	351	3	209	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
215090	PLN00176	1.90e-09	165	347	102	258	galactinol synthase
227884	Gnt1	2.85e-08	158	199	150	191	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
133064	GT8_GNT1	3.86e-08	165	199	81	115	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133037	GT8_A4GalT_like	7.59e-08	158	348	66	240	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO57054.1|GT8	2.96e-227	1	445	1	445
QSS72023.1|GT8	4.07e-85	9	357	17	286
SMY20371.1|GT8	1.62e-84	6	358	11	282
QSS57188.1|GT8	2.29e-84	9	357	17	286
SMR45206.1|GT8	6.45e-84	6	358	11	282

PDB Hits     

AEO57054.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O80518|GOLS3_ARATH	4.84e-09	165	354	95	260	Galactinol synthase 3 OS=Arabidopsis thaliana OX=3702 GN=GOLS3 PE=1 SV=1
sp|Q9XGN4|GOLS1_AJURE	1.53e-08	165	354	102	266	Galactinol synthase 1 OS=Ajuga reptans OX=38596 GN=GOLS1 PE=1 SV=1
sp|Q5UNW1|YR707_MIMIV	1.93e-08	160	356	78	236	Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R707 PE=4 SV=1
sp|O22693|GOLS4_ARATH	2.05e-08	165	354	102	267	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1
sp|C7G304|GOLS2_SOLLC	1.56e-07	165	354	103	267	Galactinol synthase 2 OS=Solanum lycopersicum OX=4081 GN=GOLS2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AEO57054.1.