CAZyme Information: AEO55462.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO55462.1
• CAZy Family: GT66
• CAZyme Description: glycoside hydrolase family 17 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286	CP003002|CGC38	30094.73	4.3524

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003002:9433468-9434439(+)

Full Sequence      

MRASVCLAVMSAVLCPARAAYQGFNYGAFFTDNTPKMQLDFQAEFKTAQNLVGAPAGGFH
SARPYTMIQWGTATDVISAVPAAIATNTNLLLGIRCSAGDAVVSNELAALQTAIPTHGTR
FTDLVVGISVGSEDLYRSSAATIASYVARVRAAVRGTPLEGTPWADPANRAVLEPVDFVG
MDAYSYWESTVPNEVGGSRAKALFDAAMDHTVAATAAVDVRKMVWITETGFPVRGHTSNE
AVPSPENAKAFWDAVGCPLFDISCAEIAGERGDDGVNSDDDACDAE

Enzyme Prediction     

No EC number prediction in AEO55462.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	5.56e-18	23	259	47	269	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	4.84e-07	130	252	108	260	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO55462.1|GH17	7.31e-208	1	286	1	286
UNI21974.1|GH17	3.36e-76	1	260	1	275
CAE7194820.1|GH17	1.12e-71	1	259	1	273
QRD89241.1|GH17	1.36e-71	14	261	13	272
QMW24858.1|GH17	1.58e-71	14	261	19	278

PDB Hits     

AEO55462.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0C7P6|EGLC_ASPTN	6.81e-74	7	261	6	272	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	2.63e-71	7	260	6	271	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	2.03e-70	14	261	13	272	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	7.37e-70	7	260	6	271	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	8.15e-70	7	260	6	271	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000446	0.999537	CS pos: 19-20. Pr: 0.9687

TMHMM  Annotations     

There is no transmembrane helices in AEO55462.1.