CAZyme Information: AEO55016.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO55016.1
• CAZy Family: AA9
• CAZyme Description: glycosyltransferase family 33 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487	CP003002|CGC23	52791.34	9.2923

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003002:7935676-7937214(+)

Full Sequence      

MPPVAAPLASMIALLLYLLLICISNLAILAAYYFLTLTKYDGPPAGSPNEPVSVHVLVLG
DVGRSPRMTYHALSIAKHGGRVNLVGYLETPPHPDIANSPGITITPIPTPPSRPASIPFL
LFAPWKVLHQVYHLTRLLARLLPPAQWILVQNPPSIPTLAIAGLVCYLRNSKLIIDWHNY
GWTILAGTRGRSHPFVALSKLYECYFGRLGHLHLTVTHAMAAQLRRPPYSLPQRILAVHD
RPAAIFRPLASPSARKEILHRVLEDFPERALIPAILSGATRLVVSSTSWTPDEDFSLLLD
ALVRYASAADTTTTTTTTTTTTTKTTDGTRTPLLAIITGKGPQRDLYVRRVAELTAAGRL
PNVRVATAFLPFADYAALLACADLGICLHKSSSGVDLPMKVVDMFGVGLPVAAYRGYESF
GELVKEGENGAGFETAEELAGILGRLLGDGGGKAELERLRRGAVKEGSRRWDEEWDSAVG
KVMGFVS

Enzyme Prediction     

EC	2.4.1.142:10	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	53	481	1.7e-147	0.9905882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	0.0	53	483	5	411	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	3.16e-120	56	440	9	364	transferase, transferring glycosyl groups
340831	GT4_PimA-like	4.74e-07	155	440	90	324	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
340844	GT4_UGDG-like	0.004	336	440	235	331	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
235070	PRK02797	0.006	362	390	207	235	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO55016.1|GT33	0.0	1	487	1	487
VBB84667.1|GT33	6.86e-203	20	486	4	448
CDP31425.1|GT33	3.50e-200	20	486	4	466
CAP65429.1|GT33	3.50e-200	20	486	4	466
QBZ55236.1|GT33	6.59e-175	52	486	37	455

PDB Hits     

AEO55016.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZD1|ALG1_ARTBC	6.85e-109	89	487	66	447	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01551 PE=3 SV=1
sp|Q6C3K2|ALG1_YARLI	4.98e-84	26	480	15	435	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALG1 PE=3 SV=1
sp|Q9BT22|ALG1_HUMAN	6.14e-82	54	479	35	457	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG1 PE=1 SV=2
sp|Q921Q3|ALG1_MOUSE	1.98e-81	56	479	37	457	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg1 PE=1 SV=3
sp|P90522|ALG1_DICDI	1.46e-80	54	447	4	415	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000002

TMHMM  Annotations     

Start	End
13	35