CAZyme Information: AEO54996.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO54996.1
• CAZy Family: AA9
• CAZyme Description: polysaccharide lyase family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330		34880.84	6.0262

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003002:7845973-7847516(+)

Full Sequence      

MKLLALASLLALTAASPTPTQPESGTPRLAKRAGISDAADIGYATLNGGTKGGAGGTVTT
VSTLAQFTAAVNEKNSDPAIVVVKGIISGNEKVRVGSNKSIIGLPGSGFKGVGLHFRRQS
NLILRNIVSSFVEADNGDGLKIEESTNVWVDHCEFFSTLDVDKDYYDGLVDSSHGSDFIT
ISHTYFHDHWKASLAGHSDSNGSQDRGKLHLTYANNYWKNINSRGPLLRFGTGHIYNSYF
ENMSTAINTRMGAQVLVQSNVFRNVTVPVTSRDSDEVGYATVIDTDLGGGLNDAPEGNMV
PDSVGYEYSLLGSGAVAGKVPGEAGAILTF

Enzyme Prediction     

EC	4.2.2.2:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	82	262	1.3e-94	0.994475138121547

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	5.17e-60	82	265	1	189	Amb_all domain.
226384	PelB	9.31e-52	61	326	59	341	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.43e-39	92	262	29	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO54996.1|PL1_7	2.43e-235	1	330	1	330
VBB80716.1|PL1_7	1.60e-169	1	330	1	331
CAP61917.1|PL1_7	4.57e-169	1	330	1	331
CDP28992.1|PL1_7	4.57e-169	1	330	1	331
AUT30983.1|PL1_7	3.07e-151	5	330	6	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	9.38e-46	42	265	6	249	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	4.16e-32	36	240	4	246	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
2QY1_A	3.66e-31	98	326	70	324	Chain A, Pectate lyase II [Xanthomonas campestris pv. campestris],2QY1_B Chain B, Pectate lyase II [Xanthomonas campestris pv. campestris]
2QXZ_A	3.66e-31	98	326	70	324	Chain A, pectate lyase II [Xanthomonas campestris pv. campestris],2QXZ_B Chain B, pectate lyase II [Xanthomonas campestris pv. campestris]
2QX3_A	3.66e-29	98	326	70	324	Structure of pectate lyase II from Xanthomonas campestris pv. campestris str. ATCC 33913 [Xanthomonas campestris pv. campestris],2QX3_B Structure of pectate lyase II from Xanthomonas campestris pv. campestris str. ATCC 33913 [Xanthomonas campestris pv. campestris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CBV0|PLYB_ASPTN	2.39e-97	36	325	32	322	Probable pectate lyase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyB PE=3 SV=1
sp|Q00645|PLYB_EMENI	2.00e-96	9	325	9	323	Pectate lyase plyB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyB PE=1 SV=1
sp|O59939|PLYB_COLGL	3.06e-94	17	330	22	331	Pectate lyase B OS=Colletotrichum gloeosporioides OX=474922 GN=PLB PE=3 SV=1
sp|B8NBC2|PLYB_ASPFN	5.22e-94	13	325	11	323	Probable pectate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyB PE=3 SV=1
sp|Q2TZY0|PLYB_ASPOR	5.22e-94	13	325	11	323	Probable pectate lyase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000281	0.999692	CS pos: 32-33. Pr: 0.4670

TMHMM  Annotations     

There is no transmembrane helices in AEO54996.1.