CAZyme Information: AEO54717.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO54717.1
• CAZy Family: AA9
• CAZyme Description: Lipase, GDSL-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433		48287.19	6.2276

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003002:6588041-6589705(-)

Full Sequence      

MVSFSSLAILGLNLAARVSSTILQNGQVRKTNFPDTRINPADYSFTTYPANATEISYKGR
WDSKHVSWWSAPGIKFGYTGKTVAITFGNLTDNGVLVGYRIGGLDWMFTNITAGATHLLV
SPETPGSNETGPINPWTFEMRVSNWAYGVQIDSVHVAAGEKLVKIPDFGRRIEVIGDSLA
AGMYTTYEGLSSWAYGLGAGLGNTEFTVTAYPGICAADQDCWGNPRGQVHQWFYTSDTSY
RASVIHGDDPEPWDFAKHPAADIVVINIGTNDRNEANNVSTEAYIDALTKIIEGIHGKWP
KAQVIVMSLWLGFYQSGNTYLPNAPDGWVKEIYDMVRWFNSDDYLRNPIIYDGVTKKTSR
TGKRAKPFVHYFNTTGIMQHNDIGPLWHPTDVGAVKVASHLQQFIRIKFGWDFYATGPEI
FHETLYWNDEPNY

Enzyme Prediction     

No EC number prediction in AEO54717.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	171	405	9.1e-19	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	2.00e-31	171	406	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	6.85e-11	172	404	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	1.35e-09	174	337	1	134	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238874	FeeA_FeeB_like	1.31e-06	170	306	3	111	SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	1.54e-04	260	401	78	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO54717.1|CE0	0.0	1	433	1	433
CDP24093.1|CE0	2.56e-276	1	433	1	436
VBB73265.1|CE0	1.04e-275	1	433	1	436
EAA35351.3|CE0	1.22e-273	1	433	1	432
CAP67836.1|CE0	3.44e-260	1	433	1	435

PDB Hits     

AEO54717.1 has no PDB hit.

Swiss-Prot Hits     

AEO54717.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000453	0.999526	CS pos: 20-21. Pr: 0.8400

TMHMM  Annotations     

There is no transmembrane helices in AEO54717.1.