CAZyme Information: AEO54301.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO54301.1
• CAZy Family: AA7
• CAZyme Description: glycosyltransferase family 66 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750	CP003002|CGC21	83544.00	8.9491

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003002:4940947-4943556(-)

Full Sequence      

MSADPLQVLASVGKGKSTRGVLRVIILALIAAAAIASRLFSVIRFESIIHEFDPWFNFRA
TKYLVANGFYNFWDWFDDRTWHPLGRVTGGTLYPGLMVTSGVIYHALRALTIPVDIRNIC
VLLAPGFSGLTAIAAYLLTNEMTPSPSAGLLAALFMGIAPGYISRSVAGSYDNEAIAIFL
LVFTFYLWIKALKQGSMLWGALCALSYGYMVASWGGYAFITCLVPLHSFVLICMGRYSTR
LYVAYTTWYALGTLASMQIPFVGFLPVKTSEHMPALGIFGFLQLLGFLDYVRSAIPSRQF
QTFLWLFAGATFGLGLLGLVIATSAGFIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPT
AWPAFFFDLNLLVWLFPVGVYLCFQQLADEHVFIVVYALFGSYFAGVMVRLMLTLTPVVC
VAAAIAVSTLLDTYLSTKSLKPQESQATEGPESKKAAKSSGLKSTSKPVVGVYALWGKSM
MVGALAVYLLLFVLHCTWVTSNAYSSPSVVLASRLPDGSQHIIDDYREAYQWLRQNTRED
AKIMSWWDYGYQIGGMADRPTLVDNNTWNNTHIATVGKAMSSREEVSYPIMRQHEVDYVL
VVFGGLLGYSGDDINKFLWMVRIAEGIWPDEVNERSFFTARGEYRVDGEATETMKNSLMY
KMSYYNYNNLFPPGQAVDRMRGARLPEVGPTLSTLEEAFTSENWIIRIYKVKDLDNLGRD
HMSAAAFDRGHKKKSKGITKKKGPRQLRID

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	22	669	4.6e-193	0.8513708513708513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	8.89e-139	37	505	17	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	2.42e-103	37	719	34	737	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	1.39e-26	51	560	32	547	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).
224720	ArnT	5.61e-04	122	328	88	284	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
396786	PMT	0.006	127	265	92	234	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO54301.1|GT66	0.0	1	750	1	750
AEO65709.1|GT66	0.0	1	750	1	747
VBB72853.1|GT66	0.0	1	750	1	746
CAE76502.1|GT66	0.0	1	750	1	749
QBZ55568.1|GT66	0.0	1	750	1	750

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	6.76e-309	21	738	15	709	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	2.03e-280	33	716	83	777	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTG_5	3.41e-261	22	718	18	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	6.84e-261	22	718	18	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTJ_5	3.76e-258	22	713	18	696	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	0.0	22	734	24	738	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	3.48e-308	21	738	15	709	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|P46975|STT3_CAEEL	1.79e-283	22	741	20	745	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt-3 OS=Caenorhabditis elegans OX=6239 GN=stt-3 PE=1 SV=1
sp|Q3TDQ1|STT3B_MOUSE	4.70e-280	33	716	80	774	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2
sp|Q8TCJ2|STT3B_HUMAN	1.05e-279	33	716	83	777	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000001

TMHMM  Annotations     

Start	End
20	42
84	106
119	138
148	168
175	192
212	234
241	263
273	291
303	325
362	384
391	413
472	494