CAZyme Information: AEO54171.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO54171.1
• CAZy Family: AA7
• CAZyme Description: glycosyltransferase family 39 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775		88551.85	9.3308

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003002:4335718-4338167(-)

Full Sequence      

MASTSTPQGTLRQRNVGVSTKKPKDGASSDVELDKLVKAAAEKSSKNSERDFKVVFVVMT
ALAFLTRFWGISHPNEVVFDEVHFGKFASYYLERTYFFDVHPPLGKLLFAFMGWLVGYDG
HFHFENIGDSYIVNKVPYVAFRSLPAILGALTVSVTYLIMWESGYSLPACIIAAGLILLD
NAHIGQTRLILLDATLVFAMACSLLCYIKFYKLRHEPFSRKWWKWLILTGFALSCDISTK
YVGLFAFITIGSAVVIDLWDLLDIKRPGGALTLAEFGKHFAARAFGLIIMPFLFYLFWFQ
VHFSILTRSGPGDDFMTPEFQETLSDNIMLANAVTIDYYDTILIKHKETKVYLHSHPDRY
PLRYDDGRVSSQGQQVTGYPFNDTNNYWQILPGGADDQKLGRHVRNHDLVRLRHLGTDTI
LLSHDVASPYYPTNQEFTTVSIADAYGERAADTLFEIRIEHGKDGQEFKSVSSHFKLIHN
PSKVAMWTHPKPLPDWGYKQQEINGNKQIAPSSNVWLVEDIVSLPPDHKRREKPERKVKT
LPFLRKWFELQRSMFWHNNQLTASHPYASLPYQWPFLLRGVSFWTQNETRQQIYFLGNPV
GWWIASSVLAIYAGIVLADQFSLRRGIDALDHRSRSRLYNSTGFFFLAWATHYFPFYVMG
RQLFLHHYLPAHLASALVTGAIVEFIFAQDSLEHEVAYQAAKAGKKTGVQKRHLSARERF
AGQSMVASWIATVVILIAVAASWYFFLPLTYGYPGLSVDQVLRRKWLGYDLHFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	59	303	2.7e-72	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	38	775	9	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.65e-82	57	307	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	4.99e-79	545	767	1	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	1.48e-17	354	503	13	170	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
224720	ArnT	3.30e-07	142	274	87	212	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO54171.1|GT39	0.0	1	775	1	775
AEO65833.1|GT39	0.0	1	775	1	777
CDP23606.1|GT39	0.0	3	775	2	773
CAP69590.1|GT39	0.0	3	775	2	773
VBB72720.1|GT39	0.0	3	775	2	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	1.19e-100	53	686	50	674	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	3.97e-94	8	671	20	681	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42933|PMT4_SCHPO	9.60e-252	23	767	34	767	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|Q59X23|PMT4_CANAL	2.02e-250	46	775	41	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	9.20e-243	58	775	58	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|F1Q8R9|POMT2_DANRE	1.21e-112	55	767	70	751	Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1
sp|Q8R2R1|POMT1_MOUSE	1.32e-112	51	766	36	736	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999913	0.000089

TMHMM  Annotations     

Start	End
54	71
96	118
139	161
189	211
241	260
280	299
594	616
636	658
725	747