CAZyme Information: AEO53918.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO53918.1
• CAZy Family: AA6
• CAZyme Description: glycosyltransferase family 17 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		42179.86	7.8153

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003002:3422187-3423260(-)

Full Sequence      

MSMLRASRQPWRWVRVAAVFCIVLLILSVARDSQSLSATTWASQDDEASDICRPHGWKPF
RTKDPGKPRKVYDLMMFNTELDHLEIRLNSTWDEVDFFVLVESRKTFTSHEKPLTLLDNF
DRFGPYHSKMIYHEIEYPPDFKPRRAWDMEDHQRNSMLTQVFPRLTGRHEPQEGDVLVVS
DVDEIPKPSTLRLLRACHFPRRLTLYSRFYYYSFQWLHRGPEWPHPQATYYQGLRRTLRP
NDLRIADGGMRPFREWEKGGLANASWHCSSCFQTVGELLGKMASFSHTSLNAEKYRDKQR
IVDHVRKGIDLWDREGEMFDRVEGNTDVPPFLLENRERFRYMLNRDGPTAGFTDVEV

Enzyme Prediction     

No EC number prediction in AEO53918.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	49	343	1.3e-86	0.9823943661971831

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398414	Glyco_transf_17	8.62e-59	49	343	58	342	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO53918.1|GT17	5.21e-280	1	357	1	357
AEO66100.1|GT17	1.34e-193	3	356	1	357
UQC80666.1|GT17	1.51e-140	46	354	69	376
UPK94287.1|GT17	2.85e-138	46	354	65	375
QBZ55398.1|GT17	4.56e-135	51	354	61	366

PDB Hits     

AEO53918.1 has no PDB hit.

Swiss-Prot Hits     

AEO53918.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.514376	0.485624

TMHMM  Annotations     

Start	End
13	30