CAZyme Information: AEO53892.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO53892.1
• CAZy Family: AA3
• CAZyme Description: glycoside hydrolase family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
884	CP003002|CGC33	97052.90	5.2309

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003002:3330497-3333685(+)

Full Sequence      

MAAPASVENVDLRQDIDPNASPAGSIDTNTTPDTEFSPPESPLQRGGPPKDARKLARTKL
ATLTTEEKVSLLTAADFWRTKAIPSKNIPAVKTSDGPNGARGGIFVGGTKAALFPCGISL
AATWNKDLLYQVGQHLADEVKARSANVLLAPTVCMHRHPLGGRNFESFSEDPLLCGKLAA
QYIKGLQEKGVAATIKHFVGNEQETNRMTINSIIAERPLRELYLRPFEIAVREAKPWALM
SSYNLVNGVHADMNTHILRDILRGEWGYDGTIMSDWGGVNSTVESIKAGCDIEFPYSDKW
RFGKVLDALKEGKIAEADIDRAAENVLTLVERTKGSDLTAEAEEREDDREETRNLIREAG
VQGLTLLKNEGSILPIDPATAKVAVIGPNANRAIAGGGGSASLNPYYTTLPLDSIRKVAK
QPVSYSQGCHIHKWLPVASPYCSDKTGKQGVSIEWFKGDKFEGQPVVFQRRTNTDLFLWD
SAPLAQVGPQWSAIVTTYLTPPSTGKHTISFMTVGPGRLYVNGQLALDLWNWTEEGEAMF
DGSIDYLVDVEMQAGRPVELRVEITNELRPIAKQKQFDMTHKYGGCRIGFKPEDKVDYLQ
EAVDAAKAADVAVVIVGLDAEWESEGYDRKSMDLPSDGSQDRLVEAVLAANPRTVVVNQS
GSPVTMPWADRVPAIIQAWYQGQEAGNALAAVLFGLDNPSGKLPCTFPRRLEDTPAYHNW
PGENLEVIYGEGMYIGYRHYDRVGVAPLFPFGHGLSYTTFEYGRPSVSPKVLGPDGGAIE
LVVAISNVGPVRGLETVQVYVRDERSRLPRPEKELVAFEKVELEPGETKHLRIPLDKYAV
GYYDTALRRWVAEQGTFRALVGASAADIKYDVAFEVKETFTWVF

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	82	294	1.7e-70	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.65e-79	76	427	48	395	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	6.64e-76	114	869	120	758	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.62e-50	364	737	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.32e-49	20	836	16	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	5.29e-46	88	329	66	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO53892.1|GH3	0.0	1	884	1	884
AEO66128.1|GH3	0.0	1	884	1	888
VBB72333.1|GH3	0.0	17	884	22	908
CDP23238.1|GH3	0.0	17	870	22	896
CAP69216.1|GH3	0.0	17	870	22	896

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	4.08e-181	60	882	10	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	9.49e-176	60	882	10	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	5.49e-150	63	879	12	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.58e-122	63	868	12	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	9.13e-115	60	878	8	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	9.40e-228	60	877	15	841	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1CA51|BGLI_ASPCL	2.24e-206	60	883	10	836	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	1.82e-202	63	883	13	837	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	9.93e-202	63	883	13	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	3.95e-201	63	883	13	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AEO53892.1.