CAZyme Information: AEO53834.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO53834.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293	CP003002|CGC36	31962.93	4.0873

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003002:3166550-3167712(+)

Full Sequence      

MHSTTTLLSLLSAAAAANGASLPRDSVCGAAAEIQCPIVFDGRVSADAQPTDFDSASTSI
FNPDYVKGNNLKWSDILQFPDAGTTHFDNETHKPFEVTLSDESIFQSQQGFRRAGLQFNG
DTNNGSPGSQGVKTIHFSVKIDPQRGLNLSHEYILVWHEAADYSANQFNFETGTIIGQEG
LPKDTYKVLNRNNQQIWSTPILEDQWQNFAITLDFNQNTLQVYYSEADEPLESVTDVVSN
NNAGEGQYQIGLLKKPTGTDDVVNSGYQESGIDEGLIYGSLFVEDSANGCVSL

Enzyme Prediction     

No EC number prediction in AEO53834.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	38	290	3.6e-76	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	2.17e-99	38	289	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB72289.1|GH131	3.56e-129	32	293	32	295
EAA36411.2|GH131	1.67e-125	4	293	52	358
QBZ59804.1|GH131	2.47e-123	31	293	65	330
UPK91234.1|GH131	3.91e-118	36	292	82	342
UQC86340.1|GH131	5.53e-113	31	293	25	301

PDB Hits     

AEO53834.1 has no PDB hit.

Swiss-Prot Hits     

AEO53834.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000546	0.999435	CS pos: 19-20. Pr: 0.9361

TMHMM  Annotations     

There is no transmembrane helices in AEO53834.1.