CAZyme Information: AEO53670.1

Basic Information

• Species: Thermothelomyces thermophilus
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Thermothelomyces; Thermothelomyces thermophilus
• CAZyme ID: AEO53670.1
• CAZy Family: AA3
• CAZyme Description: glycoside hydrolase family 26 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	CP003002|CGC8	52765.63	4.2719

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TthermophilusATCC42464	9292	573729	195	9097

• Gene Location: location=CP003002:2403634-2405410(+)

Full Sequence      

MARTLRYLLCGILALAAGSNAVPAARGSTRAAPAAEPSTSATTYEAEDAILSGTTVDTAQ
EGYTGSGYVTGFDEASDKITFEVESEATKLYDLSIRIAAIYGDKHTTVVLNGGASSDVSF
PAGDTWVDVPAGQVLLNEGANTIEIVSNWGWYLVDSITLTPSAPRPEHQINRSLNNPSAD
ASARALYDYLRSIYGKKILAGQQDLTWADYVTQQTGKTPALVSVDLMDYSPSRVERGTKG
TSVEEAITHAERGGIVSALWHWNAPAGLYDTDEHPWWSGFYTDATDFDVAAALSSTDNAN
YTLLLRDIDAIAVQLKRLRDARVPVLWRPLHEAEGGWFWWGAKGPDPAKQLYALLYDRLV
NHHGINNLIWVWNSLSPDWYPGDDTVDILSADVYAQGNGPMSTQYNQLIDLGKDKKMIAA
AEVGAAPLPDLLQAYEAHWLWFAVWGDTFINNAEWNSPEVLKTVYTSDYVLTLDEIQGWQ
DS

Enzyme Prediction     

EC	3.2.1.78:14	3.2.1.151:5	3.2.1.4:3	3.2.1.78:13	3.2.1.151:5	3.2.1.4:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	176	475	2.2e-107	0.9933993399339934
CBM35	44	159	2.3e-35	0.9915966386554622

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396639	Glyco_hydro_26	9.09e-78	176	475	2	311	Glycosyl hydrolase family 26.
271152	CBM35_mannanase-like	2.76e-55	42	160	1	119	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
293595	CBM_35	2.19e-29	44	161	2	119	Carbohydrate binding module (family 35). This is a mannan-specific carbohydrate binding domain, previously known as the X4 module. Unlike other carbohydrate binding modules, binding to substrate causes a conformational change.
271149	CBM35_Lmo2446-like	7.41e-18	42	148	1	111	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
226609	ManB2	1.93e-15	323	425	180	297	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO53670.1|CBM35|GH26	0.0	1	482	1	482
AXG24384.1|CBM35|GH26	3.04e-275	1	482	1	487
AAQ31840.1|CBM35|GH26|3.2.1.78	8.69e-275	1	482	1	487
VBB80704.1|CBM35|GH26	2.04e-259	6	480	3	468
CAP61906.1|CBM35|GH26|3.2.1.78	2.90e-259	6	480	3	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	2.93e-259	43	480	14	451	Chain A, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	1.52e-105	174	476	7	310	Structure of Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	1.02e-57	170	479	30	355	Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	7.83e-52	176	477	25	328	The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6HF2_A	2.19e-46	162	447	33	316	The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q4H7|MA26A_MYCTT	0.0	1	482	1	482	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
sp|P49425|MANA_RHOM4	1.14e-110	45	480	20	461	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
sp|Q5AWB7|MANE_EMENI	3.64e-103	176	479	30	353	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
sp|A2R6F5|MA26A_ASPNC	1.39e-88	178	474	32	331	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
sp|P55298|MANC_PIRSP	3.02e-85	44	479	23	462	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004850	0.995107	CS pos: 24-25. Pr: 0.9662

TMHMM  Annotations     

There is no transmembrane helices in AEO53670.1.