CAZyme Information: ACLA_099040-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_099040-t26_1-p1
• CAZy Family: GT69
• CAZyme Description: glycosyl transferase family 8 family, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	DS027058|CGC2	36525.12	4.6248

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027058:1117006-1117965(+)

Full Sequence      

MPPNQEAENSKPPNTEMGIEPDLSHPRYAFATILTGGSNREADLKDPYFIATRLLTYQLL
HSPQTRSSADIPFLVLVTKDISQDRRDLLSRDGAIVVPVESFSREWIHPKWERWNDVLAK
LNLWKLTEYEKITFLDADSVIFEQLDGIFTHPATTIQKTRPSTPAVNMTGLLPDEYMIAG
IHDTWVEVELPPVPGKEFYARDNYMNAGFFVYSPSEAIFNYYLTLLDQPELFDPTYPEQN
LLNYAHRVDGRMPWQDIGAGWSEKGGRPQNYENGLKSLHQKWWSTSYDKALDERIASVMA
EFKDYLGKLEGGNTEIVSL

Enzyme Prediction     

No EC number prediction in ACLA_099040-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	46	251	1e-28	0.7120622568093385

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	6.25e-27	28	243	1	164	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	7.44e-18	27	297	59	348	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
215090	PLN00176	5.27e-08	72	243	54	220	galactinol synthase
132996	Glyco_transf_8	1.24e-07	66	268	25	231	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
133064	GT8_GNT1	2.98e-04	59	152	17	115	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW44321.1|GT8	2.13e-121	26	305	80	365
BAE62267.1|GT8	2.13e-121	26	305	80	365
UDD57256.1|GT8	1.98e-119	27	305	81	365
QMW32290.1|GT8	8.01e-119	27	305	81	365
QRD83739.1|GT8	8.01e-119	27	305	81	365

PDB Hits     

ACLA_099040-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43061|MU136_SCHPO	6.96e-25	27	293	56	346	Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug136 PE=1 SV=1
sp|Q09680|YA0C_SCHPO	3.61e-16	27	306	68	363	Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.12c PE=4 SV=1
sp|O43062|YGT9_SCHPO	1.92e-14	27	309	74	367	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1
sp|Q947G8|GOLS1_SOLLC	2.68e-13	72	301	51	293	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1
sp|O80518|GOLS3_ARATH	2.50e-12	66	298	41	297	Galactinol synthase 3 OS=Arabidopsis thaliana OX=3702 GN=GOLS3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ACLA_099040-t26_1-p1.