CAZyme Information: ACLA_085630-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_085630-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: cell wall glucanase (Scw4), putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	DS027060|CGC9	38940.90	6.3966

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027060:1874013-1875291(-)

Full Sequence      

MKAKLLIGLLTLRLVFHAAAHPHAGHRRHVQRDGNPLDPVIVWVDKAGQIVHVEDDKHQT
PNAAQEPTDLSLPLPLPAANDLLSHLPIQVPDLTPEPGPPAPAGPPPRRFGISYSPYNSD
STCKTPAQIDADVARLTHHAFIRIYGVDCDQTRLVTQAAKTHGMRVFAGVFDLPNLPASL
DAITAAAAGDWAPFHTISIGNELVNRGASTPADVVAALHTARAALRAAGYQGPVVTVDTF
AALQRHPELCAASDYCAANCHAFFDEGMTPERAGEYAMEQARRVSEAAGGKRTVIAESGW
PHAGRANGRAVPSKENQRVAVESLRRVFAGEPDLVLFSAFDDLWKTDGEGTFDAEKFWGI
QE

Enzyme Prediction     

No EC number prediction in ACLA_085630-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	118	360	1.1e-22	0.932475884244373

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	9.63e-72	111	360	47	300	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.52e-04	170	360	51	296	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACQ00076.1|GH17	2.33e-140	25	362	8	363
CAK47997.1|GH17	5.21e-124	4	362	3	362
BCS13276.1|GH17	1.71e-122	4	362	3	362
BCS01560.1|GH17	1.71e-122	4	362	3	362
QMW24913.1|GH17	4.25e-114	57	360	36	323

PDB Hits     

ACLA_085630-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	1.65e-71	111	360	128	375	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	2.05e-65	111	360	138	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	3.53e-62	111	360	135	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|A1C499|BTGE_ASPCL	2.34e-40	99	362	298	562	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|A1DBG6|BTGE_NEOFI	2.80e-40	109	359	295	546	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999744	CS pos: 20-21. Pr: 0.9736

TMHMM  Annotations     

There is no transmembrane helices in ACLA_085630-t26_1-p1.