CAZyme Information: ACLA_081650-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_081650-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: cellulase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316	DS027060|CGC8	35053.38	4.6501

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027060:745892-747141(-)

Full Sequence      

MKFGNLILIAAAAGSAVAAPAKEQKKRSSVFQWVGINESGAEFGEKTIPGEYGTEYIFPD
PSSISTLIGKGMNIFRIQFLMERLVPNSMTGSYNADYLANLTSVVDAVTKAGSYAILDPH
NYGRFNGEIITSTDDFQAFWKNLAGEFKSNDLVIFDTNNEYHDMDQDLVLNLNQAAINGI
RAAGATEQYIFVEGNSWSGAWTWPEINDNMKDLTDPRTRSGLRVYHHRQGKSDGRPQWLK
DNGKVGILGEFAGGVNKQCRTAISGMLEYMADNTDVWKGAMWWAAGPWWGDYMFNMEPET
GAAYKGMLDLLEPYLG

Enzyme Prediction     

EC	3.2.1.4:38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	33	293	1e-89	0.9964539007092199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.59e-56	37	286	2	272	Cellulase (glycosyl hydrolase family 5).
225344	BglC	1.69e-16	28	316	42	392	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAN16396.1|GH5_5	2.61e-167	1	316	1	332
QRD88581.1|GH5_5	7.74e-167	1	316	1	333
BAE56461.1|GH5_5	7.74e-167	1	316	1	333
QMW25446.1|GH5_5	7.74e-167	1	316	1	333
QMW37515.1|GH5_5	7.74e-167	1	316	1	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I77_A	5.61e-158	30	315	1	302	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
5I79_A	4.93e-157	30	315	3	304	Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger],5I79_B Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger]
5I78_A	5.11e-157	30	315	4	305	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger],5I78_B Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
1GZJ_A	1.70e-143	30	315	2	304	Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus],1GZJ_B Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus]
1H1N_A	8.28e-142	28	315	1	305	Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus],1H1N_B Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DME8|EGLB_NEOFI	6.74e-188	1	316	1	329	Probable endo-beta-1,4-glucanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglB PE=3 SV=1
sp|Q2UPQ4|EGLB_ASPOR	1.38e-167	1	316	1	333	Probable endo-beta-1,4-glucanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglB PE=3 SV=1
sp|B8MW97|EGLB_ASPFN	1.38e-167	1	316	1	333	probable endo-beta-1,4-glucanase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=eglB PE=3 SV=1
sp|Q96WQ8|EGLB_ASPKW	1.09e-166	1	315	1	332	Probable endo-beta-1,4-glucanase B OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=eglB PE=3 SV=1
sp|O74706|EGLB_ASPNG	2.01e-164	1	315	1	331	Endo-beta-1,4-glucanase B OS=Aspergillus niger OX=5061 GN=eglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000309	0.999667	CS pos: 18-19. Pr: 0.9814

TMHMM  Annotations     

There is no transmembrane helices in ACLA_081650-t26_1-p1.