CAZyme Information: ACLA_081220-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_081220-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: acetyl xylan esterase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308		33364.58	8.7227

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027060:623947-624981(+)

Full Sequence      

MAPFSFLLTLLLYTLSAGASVLESRSSALLPRAGSLQQVTNFGDNPTNVGMYIYVPNNLA
SNPGIIVAIHYCTGTAEAYYNGSPYAKLAEKHGFIVIYPESPYQGKCWDVSSRASLTHNG
GGNSNSIANMVKWTIKKYKTNTSKVFVTGSSSGAMMTNVMAATYPDMFAAGVVYSGVAAG
CFMSNTNQQAAWNSTCAHGKSIATPEAWAHVAKAMYPGYDGPRPRMQIYHGSADTTLYPQ
NYQETCKEWAGVFGYDYNAPRSVENNKPQANYKTTTWGKELQGIYATGVGHTVPINGDRD
MAWFGFAK

Enzyme Prediction     

EC	3.1.1.72:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	48	282	1.4e-22	0.9251101321585903

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	4.46e-37	51	259	1	204	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	7.33e-22	32	294	30	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	2.80e-21	53	241	5	187	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
395257	Peptidase_S9	2.46e-06	93	178	14	99	Prolyl oligopeptidase family.
224423	DAP2	1.96e-05	51	177	382	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADX07526.1|CE1	4.45e-170	1	307	1	300
QMW35424.1|CE1	7.40e-166	5	308	5	307
QMW47486.1|CE1	7.40e-166	5	308	5	307
QRD91842.1|CE1	7.40e-166	5	308	5	307
UDD64533.1|CE1	7.40e-166	5	308	5	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	6.28e-165	33	307	1	275	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CSZ8|AXE1_ASPCL	5.02e-233	1	308	1	308	Probable acetylxylan esterase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=axeA PE=3 SV=1
sp|Q0C8Z1|AXE1_ASPTN	1.23e-172	1	307	1	311	Probable acetylxylan esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=axeA PE=3 SV=1
sp|B8NBI2|AXE1_ASPFN	1.31e-166	5	308	5	307	Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=axeA PE=3 SV=1
sp|Q75P26|AXE1_ASPOR	5.34e-166	5	308	5	307	Acetylxylan esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=axeA PE=1 SV=1
sp|A9JPE6|AXE1_ASPFL	5.34e-166	5	308	5	307	Probable acetylxylan esterase A OS=Aspergillus flavus OX=5059 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001439	0.998546	CS pos: 19-20. Pr: 0.8162

TMHMM  Annotations     

There is no transmembrane helices in ACLA_081220-t26_1-p1.