CAZyme Information: ACLA_078620-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_078620-t26_1-p1
• CAZy Family: GT15
• CAZyme Description: glucan 1,4-alpha-glucosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617	DS027057|CGC2	67070.49	7.2696

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

Full Sequence      

MRFLSTAVGIASVLGQLAGASPVSDISERSLRLEAFIAKEGLLSYQNILKAIGNTGSNAP
GTAAGLFIASPSLVNPDYFFTWTRDSALTIQGLIEIFLTANNFLGIDYQPLKGHIQDYIS
SQAILQNVTNPSGGLSDGAGLGEPKFEVNLNPYTGAWGRPQRDGPALRAIAMLTYMQHLI
KKGEKSVASDLVWPVVANDLAYVAQYWNSTGFDLWEEVDGSSFFTSAAQHRAMVEASTVA
KALGKPFETYDAIAPQILCFLQTYWNGKNIVSNINTNNGRTGIDLNSVLTSIHMFDPEAG
CDDATFQPCSSKALANHKVYVDSFRSIYTANAGRGKGQPANVGRYPEDVYQGGNPWYLAT
LAAAEQLYDALYVWRKQGSLTVTEISLPFFRDFSDTIKPGTYRANSATYQSLTRAVGNYA
DGFTSLVQESTPRNGSLAEQYTRDTGAPISAGDLTWSYAAFLSAVQRRASIVPGSWGAGR
ANTVPATCKAVTVRGTYAVAKPPFPFSSTKCIPAKRVPVTFWLTASTYWGQNVFMTGNTT
ALGNWNTTAGYALSSALYTEANQLWVASVEELKPGETIEYRFYKVEPDRSITWESTKKRV
YTVPTGCPMSPQLTATW

Enzyme Prediction     

EC	3.2.1.3:94	1.14.99.55:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	46	465	1e-73	0.9916897506925207
CBM20	517	607	2.6e-21	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395586	Glyco_hydro_15	2.90e-132	45	464	7	415	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
99886	CBM20_glucoamylase	6.56e-46	511	617	1	106	Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain. Glucoamylases are inverting, exo-acting starch hydrolases that hydrolyze starch and related polysaccharides by releasing the nonreducing end glucose. They are mainly active on alpha-1,4-glycosidic bonds but also have some activity towards 1,6-glycosidic bonds occurring in natural oligosaccharides. The ability of glucoamylases to cleave 1-6-glycosidic binds is called "debranching activity" and is of importance in industrial applications, where complete degradation of starch to glucose is needed. Most glucoamylases are multidomain proteins containing an N-terminal catalytic domain, a C-terminal CBM20 domain, and a highly O-glycosylated linker region that connects the two. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
395557	CBM_20	7.50e-29	517	607	1	89	Starch binding domain.
215006	CBM_2	2.62e-23	517	605	1	88	Starch binding domain.
119437	CBM20	3.46e-22	519	617	2	96	The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EPS30575.1|CBM20|GH15|3.2.1.3	EPS30575.1|CBM20|GH15|3.2.1.3	3.58e-272	9	617	8	614
CEI69823.1|CBM20|GH15	CEI69823.1|CBM20|GH15	4.50e-222	3	617	8	627
QPC79615.1|CBM20|GH15	QPC79615.1|CBM20|GH15	1.72e-220	1	617	26	652
SCB64900.1|CBM20|GH15	SCB64900.1|CBM20|GH15	2.17e-219	1	617	35	665
CZS85061.1|CBM20|GH15	CZS85061.1|CBM20|GH15	2.27e-219	1	617	26	656

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FHV_A	6FHV_A	5.26e-272	33	617	8	592	Crystal structure of Penicillium oxalicum Glucoamylase [Penicillium oxalicum 114-2]
2VN4_A	2VN4_A	1.25e-212	33	604	2	583	Chain A, GLUCOAMYLASE [Trichoderma reesei],2VN7_A Chain A, GLUCOAMYLASE [Trichoderma reesei]
6FRV_A	6FRV_A	2.17e-202	33	617	3	615	Structure of the catalytic domain of Aspergillus niger Glucoamylase [Aspergillus niger]
3EQA_A	3EQA_A	1.73e-182	33	497	3	458	Catalytic domain of glucoamylase from aspergillus niger complexed with tris and glycerol [Aspergillus niger]
6FHW_A	6FHW_A	1.07e-181	1	604	1	593	Chain A, Glucoamylase P [Amorphotheca resinae],6FHW_B Chain B, Glucoamylase P [Amorphotheca resinae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14804|AMYG_NEUCR	sp|P14804|AMYG_NEUCR	1.22e-208	24	617	30	625	Glucoamylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gla-1 PE=1 SV=3
sp|P69328|AMYG_ASPNG	sp|P69328|AMYG_ASPNG	8.81e-202	23	617	17	639	Glucoamylase OS=Aspergillus niger OX=5061 GN=GLAA PE=1 SV=1
sp|P69327|AMYG_ASPAW	sp|P69327|AMYG_ASPAW	8.81e-202	23	617	17	639	Glucoamylase OS=Aspergillus awamori OX=105351 GN=GLAA PE=1 SV=1
sp|P23176|AMYG_ASPKA	sp|P23176|AMYG_ASPKA	1.38e-200	21	617	15	638	Glucoamylase I OS=Aspergillus kawachii OX=1069201 GN=gaI PE=1 SV=1
sp|P22832|AMYG_ASPUS	sp|P22832|AMYG_ASPUS	3.92e-200	21	617	15	638	Glucoamylase OS=Aspergillus usamii OX=186680 GN=glaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000300	0.999685	CS pos: 20-21. Pr: 0.9660

TMHMM  Annotations     

There is no transmembrane helices in ACLA_078620-t26_1-p1.