CAZyme Information: ACLA_078430-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_078430-t26_1-p1
• CAZy Family: GT109
• CAZyme Description: aryl-alcohol dehydrogenase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618		66990.43	5.3491

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027057:285681-287588(-)

Full Sequence      

MDEYDYIIVGAGIGGLVLANRLSEDPSVKILLIEAGANRMGDPRIDTPGFMGTLYGHPDF
DWDYMSVPQARPRPLRAALYSSYPCSCLILPPQRQIAQPRGRVVGGSSAMNFSVIVYPST
SNFDAWKELGNDGWAAADMAPYLRRFHTYSPPTAATAELLGVDRYMDPQNQGSDGPLPVS
LPDVYGPLNQAWDETFARLGWQSDADPIAGKKIGAFTAPLSVDATTGKRGYAAAYYTPEV
AARPNLHLMAETLVERIVLEKGAEVVARGVQVSTKDGPKEIRAKKEVILCAGSLNSPQLL
ELSGIGHADLLRQHDIPVAVDLPGVGENLQDHCLTTINFEIADGQVSGDILRDPTVVQAL
VKLYEETRSGPLAGMPISMAYLPFVDGQGAVPADKVEELLAQHLDGKDYAPALQKQYDVL
RRMLQDGSDASSQYLLLPAQLHMKPGPTTMADVLAKQLPGNYISIMVLHNHPFSRGSVHI
SSARATDKPVYDPNYLSHPLDLEILARHTQFVDQIVRTAPFADLLKGARMPENTADLSDL
EHAKGVVKERLFTCFHPAGSCAMLPREMGGVVDSRLKVYGTSNLRVVDASVFPLEPAGNI
QAATYAVAEKAADLILCK

Enzyme Prediction     

No EC number prediction in ACLA_078430-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	616	8.2e-174	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.53e-102	1	616	3	532	choline dehydrogenase; Validated
225186	BetA	4.36e-97	3	617	7	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.58e-38	472	611	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.52e-30	99	332	22	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.01e-20	4	602	56	563	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR96633.1|AA3_2	3.85e-315	1	615	4	605
CAK96255.1|AA3_2	5.46e-315	1	615	4	605
QMW28733.1|AA3_2	2.34e-279	2	615	6	606
QRD83267.1|AA3_2	2.34e-279	2	615	6	606
UDD56791.1|AA3_2	3.32e-279	2	615	6	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.46e-82	4	615	6	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	5.43e-70	2	615	4	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	2.12e-59	3	615	1	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.10e-58	3	615	2	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6O9N_A	1.69e-57	2	616	34	639	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	3.44e-103	4	615	14	608	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	3.44e-103	4	615	14	608	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	5.29e-97	5	616	15	617	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.28e-88	5	615	41	629	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	3.91e-76	3	616	46	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.993027	0.006986

TMHMM  Annotations     

There is no transmembrane helices in ACLA_078430-t26_1-p1.