CAZyme Information: ACLA_077810-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_077810-t26_1-p1
• CAZy Family: GH93
• CAZyme Description: glycosyl hydrolase family 88, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
451	DS027057|CGC3	49414.23	6.8834

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027057:133809-135335(-)

Full Sequence      

MKIFHALSCLLSLTLVIRTGQAVSYPKHSTWMLESVIGRGEGINPADGLLGVIQKGLFQQ
ALRAAIAQSSDAEEIARWTDYHRRSVDADIEELLNATASSRDLSLDRLCVGRSIMEMNLD
EPLHRNVLKALRKSLDLQYQNENSGFWYFVDPPPPYPPYGNLSYSDGMYGFAPFAALYGI
TYGDPHVNLEAALLQLDLLYRQSIEPSTGLIKHGYDGSRDAPWAHPITGASPIVWGRSLA
WYLIGALDTLEIAKSKYGNGGALNAMQKDKTVQRILDIFQRLAKATVKVIQDSARKTGRY
AVWQVMDQAGEKGNFVEASAGAMVAYVLAKGVRLGFLPGSGSTQSTKIGSGHGAPSSLRV
QGAVRQPSEQMWAEDVADVARALYKDVVGHFVVRSVEEGSCLNFLGTSIIASLHEEKPYY
EYYTHRAVTTNSLIGTSAFALASLEMERMGV

Enzyme Prediction     

No EC number prediction in ACLA_077810-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	58	339	7.3e-38	0.7439759036144579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	3.10e-28	166	448	135	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	7.86e-26	77	449	49	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE47860.1|GH105	2.32e-216	1	421	76	496
QDS73972.1|GH105	5.03e-64	36	447	1	352
CAE7031832.1|GH105	1.84e-63	32	449	1	371
SMQ49260.1|GH105	1.12e-61	32	449	37	424
SMY22959.1|GH105	3.09e-61	32	449	37	424

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.79e-28	27	449	3	361	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.12e-21	77	447	61	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	8.65e-21	77	447	51	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	1.09e-20	77	447	61	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	4.57e-17	173	349	4	159	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	4.57e-17	173	349	4	159	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000184	0.999815	CS pos: 22-23. Pr: 0.9819

TMHMM  Annotations     

There is no transmembrane helices in ACLA_077810-t26_1-p1.