CAZyme Information: ACLA_074380-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_074380-t26_1-p1
• CAZy Family: GH76
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258		28658.68	4.5853

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027045:2008571-2009711(+)

Full Sequence      

MDKMKSLLFFLPLVRCEVLWNGFFDENFTVAHFDKWSWSNQIPPYQWYIHGSQPTSHYLG
LSADFKNPAATSDAQGIRITIDDTSSWNGQTMMRSEIIPQTTANLGKGHLFYHFSLSTRE
TNAPSPGFEHQIAFFESHFTELKYGRLSGATEDDNTLRWMVGGQTHWSTPLAAGTWYNFA
YDIDFDAGTVGLWVSEGAAPLARAVENVPAATSTNSQDWHVGELRLDNGGASGPAEDWFW
SGVYVESGEVTTGVAGPV

Enzyme Prediction     

No EC number prediction in ACLA_074380-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	18	256	5.4e-96	0.9921568627450981

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	9.91e-89	18	251	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW42809.1|GH131	4.92e-126	4	257	1	248
QRD89644.1|GH131	4.92e-126	4	257	1	248
QMW30756.1|GH131	4.92e-126	4	257	1	248
UDD59586.1|GH131	4.92e-126	4	257	1	248
QQK47469.1|GH131	1.29e-123	4	257	1	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LE3_A	1.21e-99	18	257	3	243	Chain A, Beta-glucanase [Podospora anserina],4LE3_B Chain B, Beta-glucanase [Podospora anserina],4LE3_C Chain C, Beta-glucanase [Podospora anserina],4LE3_D Chain D, Beta-glucanase [Podospora anserina],4LE4_A Chain A, Beta-glucanase [Podospora anserina],4LE4_B Chain B, Beta-glucanase [Podospora anserina],4LE4_C Chain C, Beta-glucanase [Podospora anserina],4LE4_D Chain D, Beta-glucanase [Podospora anserina]
3W9A_A	1.21e-95	17	252	2	229	Chain A, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_B Chain B, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_C Chain C, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_D Chain D, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130]

Swiss-Prot Hits     

ACLA_074380-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.642057	0.357960

TMHMM  Annotations     

There is no transmembrane helices in ACLA_074380-t26_1-p1.