CAZyme Information: ACLA_073210-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_073210-t26_1-p1
• CAZy Family: GH75
• CAZyme Description: GPI anchored endo-1,3(4)-beta-glucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639		65107.87	4.2578

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027045:1653877-1655796(-)

Full Sequence      

MAPSSLLLSVGSLIASSLASATSLQIREQSQSYQLTESWQGESFINDWNFFDRGDPTNGY
VTYVNQSVAESSGLVKVTQSGSFYMGVDYESKLNPDGPGRESVRIESKKYYTQGLYVVDI
AHMPGSICGTWPAFWSVGANWPHDGEIDIIEGVNKHDANEIVLHTSGSCDVAGSHDMTGS
LTSGECGDASGTIGCVVKGTQGSAGDPFNAQGGGVYAIEWTDSFLKIWFFPRNSIPASIT
AGKPDSSAFGTPMAHLQGTCDFAERFKEQKFILDTTFCGDWAGNVFGESGCPLSDASSPM
RSCVDYVAQNPAAFKEAYWEINSIKIYQLGAAPAPATVASPNTASEVHSASELAPATQTE
KPTVPTAAETTVVPPASQTSTVAEETPIAPLATAATVTAVNPAPPATQPTAEPATAVTVT
DGGDSFRTIFLTSTTTICPEAQSSSSAAAHGGNKNAPVGAVPGQPSGADAVGNPNPSTTT
EAVAETETSQPELTAGGISELPKSAPAPTASQPTSEFKPSDVPDVPKPSPEAEHPAPPAA
AGSSIINTPSSSAIFGSSTAVGTFTSLARVSRPTGGATFVPTIATATGSPTVGEDGSSGS
ATASATLTAPTGILFTAGARKLSVGLSGLVGALAVAALA

Enzyme Prediction     

EC	3.2.1.39:3	3.2.1.-:1	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	73	307	3.4e-86	0.982532751091703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185690	GH16_fungal_Lam16A_glucanase	7.92e-153	32	328	1	293	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
185693	GH16_laminarinase_like	8.48e-18	89	307	53	232	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
235906	PRK07003	1.02e-07	330	529	378	598	DNA polymerase III subunit gamma/tau.
185691	GH16_Strep_laminarinase_like	1.15e-07	129	223	106	184	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
223021	PHA03247	3.96e-07	330	607	2730	3013	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAL93731.1|GH16_1|3.2.1.39	8.30e-224	1	639	1	652
XP_755769.1|GH16_1|3.2.1.39	8.30e-224	1	639	1	652
ACQ08899.1|GH16_1|3.2.1.39	6.12e-203	1	369	99	466
BAE58669.1|GH16_1	3.25e-174	1	438	1	441
QRD85212.1|GH16_1	1.47e-172	1	438	1	441

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVV_A	3.17e-123	31	327	1	297	Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila'],5JVV_B Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila']
3WDU_A	6.75e-86	33	327	2	295	The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_B The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_C The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_D The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila']
3WDT_A	6.98e-86	33	327	3	296	The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_B The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_C The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_D The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDV_A The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_B The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_C The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_D The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDY_A	5.06e-85	33	327	1	294	The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_B The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_C The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_D The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDW_A	5.40e-85	33	327	3	296	The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDW_B The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDX_A The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila'],3WDX_B The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1C7B5|EGLX_ASPCL	0.0	1	639	1	639	Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=ACLA_073210 PE=3 SV=1
sp|B0XTU6|EGLX_ASPFC	1.48e-224	1	639	1	652	Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_029980 PE=3 SV=1
sp|Q4X084|EGLX_ASPFU	1.48e-224	1	639	1	652	Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_2G14360 PE=3 SV=1
sp|A1DHY9|EGLX_NEOFI	1.61e-218	1	639	1	651	Probable endo-1,3(4)-beta-glucanase NFIA_089530 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_089530 PE=3 SV=1
sp|Q2UIE6|EGLX_ASPOR	5.77e-175	1	438	1	441	Probable endo-1,3(4)-beta-glucanase AO090023000083 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000083 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000386	0.999568	CS pos: 21-22. Pr: 0.9130

TMHMM  Annotations     

There is no transmembrane helices in ACLA_073210-t26_1-p1.