CAZyme Information: ACLA_072740-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_072740-t26_1-p1
• CAZy Family: GH74
• CAZyme Description: DUF821 domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446	DS027045|CGC9	50986.97	8.2139

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027045:1527993-1529405(-)

Full Sequence      

MRWTQGQSPWLRFLAPGAAVSLLIVTFLVLASRYSSDYARYALKSSMRPAPPSMLHPCPA
VNQSTTDWEFTVERDGDNHGLSEEQCRVAFPKLFVEIDKSVTMRREKPVTFREVDGVSVD
DGMVRAAIYRGELYVIDYAAMPYTYSRAKATLNALHRALMAFPDRHSLPNVEFVFTTDDF
SNTPGPIWSYSKRDEDDSIWLMPDFGYWSWPEVKIGAYKDIRRRIATVDSGTTTSDGKII
PGLEFKKKKKQLVWRGSVATNPEIRGKLLKAAQGRSWASIRVIDWDNENDIRYNLLPMED
HCRYMFLAHTEGRSFSGRGKYLLNCRSVVVSHKLVWREAHHAALVASGPDANYVKVERDF
SDLDRKISFLIDNPETAEQIADNAVRTFRDRYLTPAAESCYWRQLIRQYAASCDFEPVLE
ELTKDGTIRTRGIPFETWILSGSGMK

Enzyme Prediction     

No EC number prediction in ACLA_072740-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	168	410	3e-30	0.972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	4.61e-28	91	421	7	331	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	2.85e-24	168	410	2	250	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13796.1|GT0	8.78e-238	1	442	1	441
BCS02108.1|GT0	8.78e-238	1	442	1	441
UDD61446.1|GT0	5.33e-231	1	440	1	436
QMW41857.1|GT0	1.24e-225	1	440	1	458
QMW29784.1|GT0	3.55e-225	1	440	1	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	5.22e-09	167	416	127	382	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q16QY8|RUMI_AEDAE	8.93e-11	163	416	133	391	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	2.82e-10	163	421	132	397	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q29AU6|RUMI_DROPS	2.74e-08	167	416	137	392	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|Q8T045|RUMI_DROME	2.76e-08	167	416	139	394	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|A0NDG6|RUMI_ANOGA	1.46e-07	186	409	163	382	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999826	0.000196

TMHMM  Annotations     

Start	End
13	35