CAZyme Information: ACLA_072460-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_072460-t26_1-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: GMC oxidoreductase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
621		67844.70	6.1136

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027045:1444358-1446438(+)

Full Sequence      

MQLQAPLLGVLASVLNTLQAWTDGIPGKWESLWSTHHTFDYVVVGGGTAGVTVAARLAEQ
NFKVALVEAGYSYEIGSPTAVIPGAASLGVGSSPGSTTAVDWHFVARAVPGANHRDIHYP
RGKCLGGSSALNFMAYQRPTRDSMQRWADLVQDQSYTFDNVLPYFKKTAHFTPPNEGLRA
PNATAQYNRNAFDRKGNHPLHVSYPAYAMPFSSWMKLGLKDVGMNETNDFNSGHLSGSQY
CSFTIRPSDQTRSSSETAFLSSLNPLSKTLKIYKGTMANRILFDSRKRATGVQVSDLLQT
FTLNARREIIISAGVFHSPQLLMVSGIGPADTLEELDIDIIRNAPGVGQNMWDHVFFGPT
YQVAVETYTKVATDLIYFINHLLQWVSAHSGVLTNPIIDYIAFEKLSNQIRANFSESTVS
DLSWFPDDWPEIEYLSAAAYVGDFSKPLLSQPSDGKQYATILGTLVAPTSRGNVTIISAD
TSDLPVINPNWLSTETDQQVAIAAYRRIRAMFQSAAMAPIVVGTEYFPGSQYETDVEILE
VIQNTVMTIYHAACTCKMGTRDDPMAVLDSRARVFGVKGLRVVDASAFPILVPGHPQSTV
YMLAEKIAADIASSSLSDTGE

Enzyme Prediction     

No EC number prediction in ACLA_072460-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	38	612	1.1e-181	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.75e-99	56	611	23	531	choline dehydrogenase; Validated
225186	BetA	1.05e-81	56	615	25	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	5.40e-42	468	607	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.96e-30	31	603	48	568	Protein HOTHEAD
366272	GMC_oxred_N	6.62e-27	112	354	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR87370.1|AA3_2	1.67e-281	21	613	29	622
BCS02136.1|AA3_2	1.28e-263	7	613	11	613
BCS13823.1|AA3_2	1.53e-263	7	613	16	618
QRD89774.1|AA3_2	4.81e-258	7	611	25	624
QMW30869.1|AA3_2	4.81e-258	7	611	25	624

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	2.24e-59	39	606	2	556	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.17e-58	39	606	3	557	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	2.83e-50	39	614	41	600	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZE2_A	6.27e-46	34	608	1	579	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3NNE_A	1.08e-45	39	619	14	534	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	1.04e-171	3	612	23	625	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	5.36e-169	36	612	49	625	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	3.61e-165	38	608	40	604	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A1U8QYA8|CICC_EMENI	2.04e-164	24	611	28	607	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|C8VDT4|STCN_EMENI	1.04e-142	38	611	67	635	Versicolorin B synthase stcN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=stcN PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.935785	0.064236

TMHMM  Annotations     

There is no transmembrane helices in ACLA_072460-t26_1-p1.