CAZyme Information: ACLA_071660-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_071660-t26_1-p1
• CAZy Family: GH71
• CAZyme Description: 1,3-beta-glucanosyltransferase Gel3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		57679.99	4.3982

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027045:1196747-1198543(-)

Full Sequence      

MRYSLVTGVSLLSGYALAGVPNIEIKGSKFFYANNGSEFYLRGVAYQEDYSGGGAGGTGQ
SSTSYIDPLADAAKCERDIPYLVQLRTNVIRTYAVDPTANHDECMQKLADAGIYVITDLA
SPDVSITSNAPVWTVEQYARYASVIDAFQKYDNLIGFFAGNEVVNQANQSAGAAFVKAAA
RDMKSYIKNKGYRKSLAIGYATTDNPEIRLPLSDYLNCGDQSEAIDFFGYNIYEWCGDKT
FQDSGYQNRTQEYEDYSIPIFFSEYGCNDEKPRKFTDVPVLFGPQMENVWSGGIVYMYFE
TTNDYGLVSVDGNTVNTEADFDYYSREIQSATPTGVNSASYSPTNSPRACPTADDSWLAK
SSPLPPIPNADLCSCMAASLSCVVKDSVAVKQYGELFGEVCGYGHGICDGIAHNATTGQY
GAYSVCSSKDQLSYVLDRYYQSQNKQASACDFAGAARVQSAQGASGDCKSLISQAGTAGT
GTVTSQPTGTGAAAGSGSAASTSTSKGAAVGAVTPAAVRVGGWPMVVYGVVAAMAGVLMI
SL

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	20	330	2.3e-130	0.9807692307692307
CBM43	381	469	1.9e-20	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	2.94e-142	12	331	1	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	5.62e-30	380	456	1	75	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	2.69e-20	380	470	1	85	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAF40140.1|CBM43|GH72	0.0	1	542	1	554
EAL93577.1|CBM43|GH72	0.0	1	542	1	544
CAP99156.1|CBM43|GH72	2.33e-255	3	484	4	482
QQK44763.1|CBM43|GH72	1.51e-244	25	484	14	474
BCR92446.1|CBM43|GH72	1.41e-221	1	542	1	531

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	5.42e-110	13	440	26	456	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	1.52e-109	13	440	26	456	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	1.52e-109	13	440	26	456	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0C955|GEL3_ASPFU	0.0	1	542	1	544	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1
sp|B0XT09|GEL3_ASPFC	1.86e-318	1	542	1	547	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel3 PE=1 SV=1
sp|P0C956|GEL4_ASPFU	8.36e-198	1	478	1	489	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|B0XVI5|GEL4_ASPFC	8.36e-198	1	478	1	489	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P56092|EPD1_CANMA	2.63e-171	4	483	9	476	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000787	0.999175	CS pos: 18-19. Pr: 0.9728

TMHMM  Annotations     

There is no transmembrane helices in ACLA_071660-t26_1-p1.