CAZyme Information: ACLA_070540-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_070540-t26_1-p1
• CAZy Family: GH65
• CAZyme Description: UDP-glucoronosyl and UDP-glucosyl transferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	DS027045|CGC6	53984.02	6.6153

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027045:812161-813789(+)

Full Sequence      

MNKRTILFLTNSELGQASVILAVAHEFLLRPEYDVHIGSFPALSPSIQSLNTQAQASTQH
IATFHPLSGQAMKDAYTDKLGGADTFAVHDIGWKGALHAYRSVLVHAMAPWSGREYMALC
LECLHVVRDLQPAAVVVDPLFAPALDACRVAGCAYIVLSPNTVKDHVVQPGLANLWQFPA
LCSGYPYPVPVSLVIPNTLLCLSLGWLMYRSPELRALTNYRNTHGVEGPLPSMIVQPGDE
TRLLIPSRPEYEFPAYVPENVTMCGPILRPWSALSQDEDENHAELAEWMAKRPTILANLG
SHVTFDNEMARQFAEGLSHLLKHVPQIHVLWKLKWKPQIIVDDRVFQSIRGAITDGRVRI
TDWIQAEPISLLMSGHVQCVVHHGGSNSFHEAIRAGVPQIILPVWFDTYDFANRVEWLGI
GIWASRQSAPAINGEHLGRALVRVLASGDSATFEAKARSIAAHLGSKEGRVVACEKIIEV
IDAGERASQD

Enzyme Prediction     

No EC number prediction in ACLA_070540-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	166	479	2.9e-19	0.7068062827225131

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.36e-33	6	483	3	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.58e-17	3	483	1	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215127	PLN02210	1.75e-06	265	435	229	399	UDP-glucosyl transferase
273616	MGT	1.02e-04	216	445	157	357	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
223071	egt	4.60e-04	290	421	294	409	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS26405.1|GT1	1.14e-178	1	481	1	483
BCR88350.1|GT1	4.68e-168	5	481	3	485
QMW30045.1|GT1	1.21e-164	1	481	1	481
UDD61742.1|GT1	1.21e-164	1	481	1	481
QMW42118.1|GT1	4.58e-160	1	473	1	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IIR_A	3.51e-08	372	481	297	398	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	6.18e-08	377	457	303	380	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]
5XVM_A	1.52e-06	377	432	343	398	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.56e-06	377	432	363	418	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3OTG_A	9.68e-06	284	469	230	395	Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP bound form [Micromonospora echinospora],3OTH_A Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora],3OTH_B Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	7.07e-112	3	468	5	461	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	2.62e-80	5	445	7	466	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	4.21e-11	358	458	443	540	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	1.29e-10	358	445	442	526	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|Q8NJS1|ATG26_LEPMC	2.19e-09	336	482	1254	1375	Sterol 3-beta-glucosyltransferase OS=Leptosphaeria maculans OX=5022 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ACLA_070540-t26_1-p1.