CAZyme Information: ACLA_066260-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_066260-t26_1-p1
• CAZy Family: GH55
• CAZyme Description: mannosyltransferase (PIG-M), putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	DS027053|CGC1	45474.33	10.0774

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027053:445170-446531(+)

Full Sequence      

MAKTSFFDSPAKVYGASIALRAVLLVYGAWQDAHSAVKYTDIDYLVFTDAARFVARGASP
YARDTYRYTPLLAWLLLPTTWSISGLFSFGKALFALADVLAGWLIAQSLVAAYGLPPARA
RKYAAVWLLNPMVANISTRGSSEGLLGVLVVALLWASLSKRVTLAGVLLGLAVHFKIYPF
IYGASIVWWMDWDSESTSSSSSRPKQPTLTPGALVAHARAFLTPARLHLTLVALATFSAL
NTSMYILYGPAFAHHTYLHHLTRIDHRHNFSPYSTLLYLSAAGAAPARFETLAFLPQLLL
SVVLIPIALAKKSLPGAMLAQTFAFVTFNKVCTSQYFLWYLVFLPFYLPKSSVRGWKGVV
AGLAWVGGQALWLQQGYGLEFLGESTFVPGLFLASLGFFVVNVWILGIIVTDVGKL

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	136	409	3e-95	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.84e-86	16	410	14	415	GPI mannosyltransferase
252941	Mannosyl_trans	7.15e-68	136	410	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	3.81e-05	49	187	39	187	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65877.1|GT50	7.43e-206	5	413	3	410
BAE66105.1|GT50	1.83e-205	5	413	28	435
QRD92382.1|GT50	1.22e-204	5	413	3	410
QMW36573.1|GT50	1.58e-204	5	413	10	417
QMW48628.1|GT50	1.58e-204	5	413	10	417

PDB Hits     

ACLA_066260-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WAH2|GPI14_ASPFU	1.05e-217	4	414	2	422	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	1.32e-206	5	413	3	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	3.37e-197	5	416	3	431	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	6.21e-167	4	415	20	487	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	3.43e-153	7	412	7	407	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.455479	0.544512	CS pos: 35-36. Pr: 0.4694

TMHMM  Annotations     

Start	End
13	30
70	89
94	116
136	158
165	187
227	249
291	310
325	347
354	373
388	410