CAZyme Information: ACLA_066240-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_066240-t26_1-p1
• CAZy Family: GH55
• CAZyme Description: beta-mannosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845	DS027053|CGC3	96759.79	5.2567

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027053:435971-438750(-)

Full Sequence      

MAALQRFPLSKGWSFKDSEDKSEDAWMPVPVVPSVVQQDLQANNKLKDPYIGFNELETRW
VNEKSWTYKTTFQKPAVPAGSAIFLAFDGLDTFATVKLDGNVILESDNMFLAHRLDVTKA
LEAEGDHSLEIDFDCAFLRAKELRKQDSKHNWASFNGDPSRLSVRKSQYHWGWDWGPVLM
TAGIWREVRLEVYTARVADLWTDVQLASDHQNAQITAFAEVESVNSDAHKARFTLSLHGQ
ELGREEVSVSEDGSAKVSFDVKSPSLWWPHGYGDATLYEVSVSLVKDQDEVHQVSKKFGI
RTAEVVQQPDKHGKSFFFRVNGVDIFCGGSCWIPADNYLPSVTADRYRKWIELMVHGRQV
MIRVWGGGNYEDDSFYDACDELGVLVWQDFMFGCGNYPTWPNLLESIRKESVYNVRRLRH
HPSIVVWVGNNEDYQVQESAGLTYDFEDKNPENWLKTDFPARYIYEKILPEVVEEYSPST
FYHPGSPWGDGKTTSDPTVGDMHQWNVWHGTQEKYQIFDTLGGRFNSEFGMEAFPHMSTI
DYFVENEADKFPQSHVLDFHNKADGHERRIATYLVENLRTATDLETHVYLTQVVQAETMM
FGYRGWRRQWGDERHCGGALLWQLNDCWPTISWAIVDYFLRPKPAFYAVARVLNPIAVGV
RREHHDWSVTHAQPPKTSKFELWVASSLQKEVQGTVELRFLSINTGLEVRERIVHENVSI
VPNGTTNLIVDGLIDYKVHPEPHVLAVRIWVNGELVARDVDWPQPFKYLDLSNRGLEVKL
VSESENEQTLLLSAQKPVKCLVFEEREGVRISDSAIDIVPGDEQRVTIKGMKPGDAPLKY
KFLGQ

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	671	6.2e-99	0.6289893617021277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.60e-80	5	658	11	634	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
395572	Glyco_hydro_2	6.30e-17	195	301	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407658	Mannosidase_ig	1.30e-15	678	768	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
236673	ebgA	2.83e-13	68	434	113	452	cryptic beta-D-galactosidase subunit alpha; Reviewed
236657	PRK10150	1.85e-08	68	432	69	417	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65874.1|GH2	0.0	1	845	1	844
QRD92384.1|GH2	0.0	1	845	1	844
QMW36571.1|GH2	0.0	1	845	1	833
QMW48626.1|GH2	0.0	1	845	1	833
BAE66106.1|GH2	0.0	1	845	1	849

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	3.00e-155	1	841	21	826	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	2.03e-133	9	843	11	834	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.14e-133	9	843	13	836	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	2.19e-133	9	843	13	836	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	5.74e-133	9	843	11	834	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB7|MANBB_ASPOR	0.0	1	845	1	844	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|B0YBU9|MANBB_ASPFC	0.0	1	845	1	845	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|B8NW36|MANBB_ASPFN	0.0	1	845	1	844	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	0.0	1	845	1	845	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|Q0CCA0|MANBB_ASPTN	0.0	1	845	1	843	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ACLA_066240-t26_1-p1.